Recombinant Vaccinia Virus Protein B5 (PS/HR) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05039P

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) PS/HR.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) PS/HR.
Recombinant Vaccinia Virus Protein B5 (PS/HR) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05039P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Vaccinia Virus Protein B5 (PS/HR) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q01227 |
Target Symbol | PS/HR |
Synonyms | PS/HR; VACWR187; B5RProtein B5; Plaque-size/host range protein |
Species | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH |
Expression Range | 18-279aa |
Protein Length | Partial |
Mol. Weight | 31.1 |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). |
Subcellular Location | Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus, host trans-Golgi network. Note=B5 is found on enveloped virion (EV) membranes. |
Protein Families | Receptors of complement activation (RCA) family |
Database References | KEGG: vg:3707658 |
Gene Functions References
- Tanslation of vaccinia virus A27L and B5R genes is independent of PKR activation, but their expression is dependent on the RNase L activity. PMID: 26656695
- These results suggest that in the absence of A33, the cytoplasmic tail of B5 contributes to its incorporation into the envelope of progeny virions. PMID: 20378144