Recombinant Vaccinia Virus Protein A33 (VACWR156) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04608P
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) VACWR156.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) VACWR156.
Recombinant Vaccinia Virus Protein A33 (VACWR156) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04608P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Vaccinia Virus Protein A33 (VACWR156) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P68617 |
| Target Symbol | VACWR156 |
| Synonyms | VACWR156; A33RProtein A33 |
| Species | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
| Expression Range | 57-185aa |
| Protein Length | Partial |
| Mol. Weight | 16.2 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Coordinates the incorporation of A36 into wrapped enveloped virion (EV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. |
| Subcellular Location | Virion membrane; Single-pass type II membrane protein. Host membrane; Single-pass type II membrane protein. |
| Protein Families | Chordopoxvirinae A33 protein family |
| Database References | KEGG: vg:3707686 |
Gene Functions References
- The localization and stability of A34 is affected by B5 and here data are presented showing that A34 is also affected by A33. PMID: 23255618
- The authors report that A33 is present as a disulfide-bonded homodimer during infection. PMID: 20947114
- Comparison of the three-dimensional A33 model to the X-ray structures of distant cellular homologues revealed that A33 retained the key residues required for adopting the C-type lectin-like fold. PMID: 20302896
- findings show that vaccinia virus spreads across one cell every 75 minutes; early expression of proteins A33 and A36 was critical for virion repulsion and rapid spread, and cells expressing these proteins repelled exogenous virions rapidly PMID: 20093437
