Recombinant Vaccinia Virus Protein A33 (A33R) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05069P
Greater than 85% as determined by SDS-PAGE.
Recombinant Vaccinia Virus Protein A33 (A33R) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05069P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Vaccinia Virus Protein A33 (A33R) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P68616 |
| Target Symbol | A33R |
| Synonyms | A33R; Protein A33 |
| Species | Vaccinia virus (strain Copenhagen) (VACV) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
| Expression Range | 57-185aa |
| Protein Length | Partial |
| Mol. Weight | 21.7 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Coordinates the incorporation of A36 into intracellular enveloped virion (IEV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. |
| Subcellular Location | Virion membrane; Single-pass type II membrane protein. Host membrane; Single-pass type II membrane protein. Note=Component of the enveloped virion (EV) membrane. |
| Protein Families | Chordopoxvirinae A33 protein family |
