Recombinant Vaccinia Virus Envelope Phospholipase F13 (VACWR052) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00626P

Greater than 90% as determined by SDS-PAGE.
Recombinant Vaccinia Virus Envelope Phospholipase F13 (VACWR052) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00626P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Vaccinia Virus Envelope Phospholipase F13 (VACWR052) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P04021 |
Target Symbol | VACWR052 |
Synonyms | (37 kDa protein)(Palmitoylated EV membrane protein)(p37K) |
Species | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | MWPFASVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKGIKIIVLLDERGKRNLGELQSHCPDINFITVNIDKKNNVGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKI |
Expression Range | 1-372aa |
Protein Length | Full Length |
Mol. Weight | 49.2 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Major envelope protein that plays a role in the biogenesis of the viral double membrane and in egress of virus from the host cell. Produces the wrapped form of virus that is required for cell-to-cell spread. Acts as a lipase with broad specificity including phospholipase C, phospholipase A, and triacylglycerol lipase activities. |
Subcellular Location | Virion membrane; Lipid-anchor. Host Golgi apparatus, host trans-Golgi network. Host endoplasmic reticulum membrane; Lipid-anchor; Cytoplasmic side. Note=Component of the inner side of the enveloped virion (EV) membrane. F13 is associated post-translationally with membranes. |
Database References | KEGG: vg:3707509 |
Gene Functions References
- VV p37 protein associates with host TIP47, Rab9 and CI-MPR. PMID: 19400954