Recombinant Ustilago Maydis P6 Virus Kp6 Killer Toxin Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03272P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Ustilago maydis P6 virus (UmV6) (UmV-P6) N/A.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Ustilago maydis P6 virus (UmV6) (UmV-P6) N/A.
Recombinant Ustilago Maydis P6 Virus Kp6 Killer Toxin Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03272P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Ustilago Maydis P6 Virus Kp6 Killer Toxin Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P16948 |
| Target Symbol | P16948 |
| Synonyms | KP6 killer toxin; Killer protein 6) [Cleaved into: KP6 killer toxin subunit alpha; VP10); KP6 killer toxin subunit beta; VP12.5)] |
| Species | Ustilago maydis P6 virus (UmV6) (UmV-P6) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS |
| Expression Range | 28-105aa |
| Protein Length | Partial |
| Mol. Weight | 10.6kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. |
| Subcellular Location | Secreted. |
