Recombinant Toxoplasma Gondii Dense Granule Protein 6 (GRA6) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-00018P
Greater than 85% as determined by SDS-PAGE.
Recombinant Toxoplasma Gondii Dense Granule Protein 6 (GRA6) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-00018P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Toxoplasma Gondii Dense Granule Protein 6 (GRA6) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q27003 |
| Target Symbol | GRA6 |
| Synonyms | GRA6; TG24; Dense granule protein 6; Protein GRA 6; Antigen p32; Protein p33 |
| Species | TOV-Toxoplasma gondii |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR |
| Expression Range | 35-150aa |
| Protein Length | Partial |
| Mol. Weight | 38.6 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Major granular component involved in excreted-secreted antigen (ESA) immunity. May have a structural role in the membranous network of the parasitophorous vacuole (PV). |
| Subcellular Location | Secreted. Parasitophorous vacuole lumen. Parasitophorous vacuole membrane. Cytoplasmic vesicle, secretory vesicle. Note=Located in dense granules of tachyzoites. Upon infection, secreted into the parasitophorous vacuole (PV) and targeted to the microvillus membranous network. |
| Protein Families | Gra6 family |
