Recombinant Tityus Serrulatus Alpha-Mammal Toxin Ts2 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04796P
Greater than 85% as determined by SDS-PAGE.
Recombinant Tityus Serrulatus Alpha-Mammal Toxin Ts2 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04796P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Tityus Serrulatus Alpha-Mammal Toxin Ts2 Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P68410 |
| Target Symbol | P68410 |
| Synonyms | ; Alpha-mammal toxin Ts2; P-Mice-beta* NaTx5.1; Tityustoxin II; Toxin II; TsTX-II; Tst2; Toxin T1-IV; TsTX III-8; TsTX-III |
| Species | Tityus serrulatus (Brazilian scorpion) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPDHIKVWDYATNKC |
| Expression Range | 1-62aa |
| Protein Length | Full Length |
| Mol. Weight | 10.9 |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin acts on Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.5/SCN5A, Nav1.6/SCN8A and Nav1.7/SCN9A voltage-gated sodium channels, with the highest affinity for Nav1.3/SCN3A, followed by Nav1.6/SCN8A and Nav1.7/SCN9A which are affected almost equally. Interestingly, shows a significant shift of the voltage dependence of activation for Nav1.3/SCN3A that is characteristic of beta-toxins. In addition, in presence of LPS, this toxin inhibits the release of NO, IL-6 and TNF-alpha in J774.1 cells. Further, in the absence of LPS, it stimulates the production of the anti-inflammatory cytokine IL-10. This toxin is active on mammals. |
| Subcellular Location | Secreted. |
| Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily |
| Tissue Specificity | Expressed by the venom gland. |
