Recombinant Tityus Bahiensis Toxin Tb2-Ii Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04798P
Greater than 85% as determined by SDS-PAGE.
Recombinant Tityus Bahiensis Toxin Tb2-Ii Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04798P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Tityus Bahiensis Toxin Tb2-Ii Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P60276 |
| Target Symbol | P60276 |
| Synonyms | Toxin Tb2-II; P-Mice-Ins-beta* NaTx5.4 |
| Species | Tityus bahiensis (Brazilian scorpion) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC |
| Expression Range | 1-62aa |
| Protein Length | Full Length |
| Mol. Weight | 10.8 |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active against both mammals and insects. |
| Subcellular Location | Secreted. |
| Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily |
| Tissue Specificity | Expressed by the venom gland. |
