Recombinant Streptomyces Coelicolor Ph-Gated Potassium Channel Kcsa (KCSA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02056P
Greater than 90% as determined by SDS-PAGE.
Recombinant Streptomyces Coelicolor Ph-Gated Potassium Channel Kcsa (KCSA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02056P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Streptomyces Coelicolor Ph-Gated Potassium Channel Kcsa (KCSA) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P0A333 |
Target Symbol | KCSA |
Species | Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
Expression System | in vitro E.coli expression system |
Tag | N-10His |
Target Protein Sequence | MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR |
Expression Range | 1-160aa |
Protein Length | Full Length |
Mol. Weight | 23.7 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a pH-gated potassium ion channel; changing the cytosolic pH from 7 to 4 opens the channel. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | Potassium channel family |
Database References | KEGG: sco:SCO7660 STRING: 100226.SCO7660 |
Gene Functions References
- Studied the expression, purification, liposome reconstitution and functional validation of uniformly (13)C and (15)N isotope labeled KcsA, a bacterial potassium channel that has high homology with mammalian channels, for solid-state NMR studies. PMID: 23916531
- Results reveal that a decrease in pH introduces major conformational rearrangements associated with channel opening in the KcsA cytoplasmic domain. PMID: 19959477
- analysis of phospholipid interactions with the potassium channel KcsA PMID: 16272446
- analysis of the potassium channel KcsA inactivation by the Shaker B "ball" peptide PMID: 18430729