Recombinant Staphylococcus Aureus Serine-Aspartate Repeat-Containing Protein D (SDRD) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10970P
Greater than 85% as determined by SDS-PAGE.
Recombinant Staphylococcus Aureus Serine-Aspartate Repeat-Containing Protein D (SDRD) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10970P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Staphylococcus Aureus Serine-Aspartate Repeat-Containing Protein D (SDRD) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | O86488 |
| Target Symbol | SDRD |
| Synonyms | sdrD; NWMN_0524; Serine-aspartate repeat-containing protein D |
| Species | Staphylococcus aureus (strain Newman) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | LVGTTLIFGLGNQEAKAAESTNKELNEATTSASDNQSSDKVDMQQLNQEDNTKNDNQKEMVSSQGNETTSNGNKLIEKESVQSTTGNKVEVSTAKSDEQASPKSTNEDLNTKQTISNQEALQPDLQENKSVVNVQPTNEENKKVDAKTESTTLNVKSDAIKSNDETLVDNNSNSNNENNADIILPKSTAPKRLNTRMRIAAVQPSSTEAKNVNDLITSNTTLTVVDADKNNKIVPAQDYLSLKSQITVDDKVKSGDYFTIKYSDTVQVYGLNPEDIKNIGDIKDPNNGETIATAK |
| Expression Range | 36-330aa |
| Protein Length | Partial |
| Mol. Weight | 38.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cell surface-associated calcium-binding protein which plays an important role in adhesion and pathogenesis. Mediates interactions with components of the extracellular matrix such as host DSG1 to promote bacterial adhesion to host cells. Contributes to the resistance to killing by innate immune components such as neutrophils present in blood and thus attenuates bacterial clearance. |
| Subcellular Location | Secreted, cell wall; Peptidoglycan-anchor. |
| Protein Families | Serine-aspartate repeat-containing protein (SDr) family |
| Database References | KEGG: sae:NWMN_0524 |
