Recombinant Staphylococcus Aureus Poly-Beta-1,6-N-Acetyl-D-Glucosamine N-Deacetylase (ICAB) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02495P

Greater than 85% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) icaB.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) icaB.
Recombinant Staphylococcus Aureus Poly-Beta-1,6-N-Acetyl-D-Glucosamine N-Deacetylase (ICAB) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02495P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Staphylococcus Aureus Poly-Beta-1,6-N-Acetyl-D-Glucosamine N-Deacetylase (ICAB) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q7A349 |
Target Symbol | ICAB |
Synonyms | icaB; SA2461Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase; PNAG N-deacetylase; Poly-beta-1,6-GlcNAc N-deacetylase; EC 3.5.1.-; Biofilm polysaccharide intercellular adhesin deacetylase; Biofilm PIA deacetylase; Intercellular adhesion protein B |
Species | Staphylococcus aureus (strain N315) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | NADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD |
Expression Range | 29-290aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 35.9 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. N-deacetylation is crucial for attachment of the polysaccharide to the bacterial cell surface; it leads to the introduction of positive charges in the otherwise neutral PIA polymer, allowing electrostatic interactions. |
Subcellular Location | Secreted, cell wall. |
Protein Families | Polysaccharide deacetylase family |
Database References | KEGG: sau:SA2461 |