Recombinant Staphylococcus Aureus Enterotoxin Type A (ENTA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05233P
Greater than 90% as determined by SDS-PAGE.
Recombinant Staphylococcus Aureus Enterotoxin Type A (ENTA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05233P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Staphylococcus Aureus Enterotoxin Type A (ENTA) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0A0L2 |
| Target Symbol | ENTA |
| Synonyms | entAEnterotoxin type A; SEA |
| Species | Staphylococcus aureus |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS |
| Expression Range | 31.0 kDa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 31.0 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, waves of cellular activation, cytokine production, and migration into the lung tissue and airways occur via alphabeta T-cells. Causes also the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death (Probable). |
| Subcellular Location | Secreted. |
| Protein Families | Staphylococcal/streptococcal toxin family |
