Recombinant Staphylococcus Aureus Alpha-Hemolysin (HLY) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03015P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain NCTC 8325) hly.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain NCTC 8325) hly.
Recombinant Staphylococcus Aureus Alpha-Hemolysin (HLY) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03015P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Staphylococcus Aureus Alpha-Hemolysin (HLY) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q2G1X0 |
| Target Symbol | HLY |
| Synonyms | hly; hla; SAOUHSC_01121Alpha-hemolysin; Alpha-HL; Alpha-toxin |
| Species | Staphylococcus aureus (strain NCTC 8325) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN |
| Expression Range | 27-319aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 35.3kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Inhibits host neutrophil chemotaxis to the lesion region (Probable). Heptamer oligomerization and pore formation is required for lytic activity. |
| Subcellular Location | Secreted. |
| Protein Families | Aerolysin family |
| Database References | KEGG: sao:SAOUHSC_01121 STRING: 93061.SAOUHSC_01121 |
Gene Functions References
- We now show that ADAM10 is critical for alpha-hemolysin-mediated activation of the NLRP3 inflammasome in human monocytes as siRNA knockdown or chemical blockade of ADAM10-alpha-hemolysin interaction leads to diminished inflammasome activation and cell death by reducing the available ADAM10 on the cell surface. PMID: 27043625
- Staphylococcus aureus hemolysin A disrupts cell-matrix adhesions in human airway epithelial cells. PMID: 24918472
- Succeeded in preparing crystals of the heptameric form of alpha-hemolysin without any detergent but with 2-methyl-2,4-pentanediol (MPD), and determined its structure. PMID: 21280135
- Staphylococcus aureus alpha-hemolysin activates the NLRP3-inflammasome in human and mouse monocytic cells PMID: 19826485
- The wide vestibule leading into the alpha-hemolysin pore helps to orient negatively charged synthetic alpha-helical peptides for translocation. PMID: 16866363
