Recombinant Shigella Flexneri Invasin Ipad (IPAD) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02710P

Greater than 90% as determined by SDS-PAGE.
Recombinant Shigella Flexneri Invasin Ipad (IPAD) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02710P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Shigella Flexneri Invasin Ipad (IPAD) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P18013 |
Target Symbol | IPAD |
Synonyms | ipaD; CP0126; Invasin IpaD; 36 kDa membrane antigen |
Species | Shigella flexneri |
Expression System | E.coli |
Tag | N-10His-SUMO&C-Myc |
Target Protein Sequence | MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF |
Expression Range | 1-332aa |
Protein Length | Full Length |
Mol. Weight | 56.6kDa |
Research Area | Microbiology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Required for bacterial invasion of host cells. Controls IpaB and IpaC secretion, and the efficiency with which they are physically inserted into target cell membranes. These proteins are exported via TTSS to form a pore in the host membrane that allows the translocation of the other effectors into the host cytoplasm. Along with IpaB, is essential for both blocking secretion through the Mxi/Spa translocon in the absence of a secretion-inducing signal, and for controlling the level of secretion in the presence of this signal. |
Subcellular Location | Secreted. Note=Secreted via the type III secretion system (TTSS). Localizes to the tip of the external secretion needle that is part of the TTSS apparatus. |
Protein Families | Invasin protein D family |
Database References | KEGG: sfl:CP0126 |
Gene Functions References
- IpaD, the putative needle-tip protein of the S. flexneri type III secretion system, has been crystallized; in-drop proteolysis resulted in the production of several new crystal forms. PMID: 16946465
- IpaD forms part of the structure at the needle tip in Shigella flexner and antibodiesblock entry of bacteria into epithelial cells. PMID: 17110044