Recombinant Shigella Flexneri Invasin Ipab (IPAB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05282P
Greater than 85% as determined by SDS-PAGE.
Recombinant Shigella Flexneri Invasin Ipab (IPAB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05282P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Shigella Flexneri Invasin Ipab (IPAB) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P18011 |
| Target Symbol | IPAB |
| Synonyms | ipaB; CP0128; Invasin IpaB; 62 kDa antigen |
| Species | Shigella flexneri |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGK |
| Expression Range | 1-312aa |
| Protein Length | Partial |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. Forms a pore with IpaC, which is inserted into the host cell membrane through the Mxi/Spa apparatus, during cell contact. This pore probably allows the translocation of IpaA. IpaB has also been found to be necessary and sufficient to activate macrophage apoptosis by binding to interleukin-1 beta converting enzyme (ICE). Has also been shown to be important, along with IpaD, to block or regulate secretion through the Mxi/Spa translocon in the presence or absence of the secretion signal, respectively. Through interaction with host human MAD2L2, constitutively activates the anaphase-promoting complex APC and induces a cell cycle arrest to prevent epithelial renewal in order to promote bacterial colonization. |
| Subcellular Location | Secreted. Host cell membrane; Multi-pass membrane protein. Host nucleus. Note=Secreted through the specialized type-III secretion system Mxi/Spa. Inserted into the host cell membrane. Also secreted into the host cell cytoplasm after the escape of bacteria from phagosome, where it colocalizes with ICE. May localize to host cell nucleus during G2/M phase of the host cell cycle. |
| Protein Families | Invasin protein B family |
| Database References | KEGG: sfl:CP0128 |
Gene Functions References
- IpaB translocon component binds cholesterol with high affinity, cholesterol-dependent association of the translocon with the target cell plasma membrane is essential for translocon activation and effector delivery into mammalian cells PMID: 15819617
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
