Recombinant Sheep Protransforming Growth Factor Alpha (TGFA) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09757P
Greater than 90% as determined by SDS-PAGE.
Recombinant Sheep Protransforming Growth Factor Alpha (TGFA) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09757P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Sheep Protransforming Growth Factor Alpha (TGFA) Protein (GST) is produced by our Yeast expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P98135 |
Target Symbol | TGFA |
Synonyms | TGFA; TGF-A; Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha; TGF-alpha; EGF-like TGF; ETGF; TGF type 1)]; Fragment |
Species | Ovis aries (Sheep) |
Expression System | Yeast |
Tag | N-GST |
Target Protein Sequence | ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ |
Expression Range | 24-97aa |
Protein Length | Extracellular Domain |
Mol. Weight | 34.9kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar. |
Subcellular Location | [Transforming growth factor alpha]: Secreted, extracellular space.; [Protransforming growth factor alpha]: Cell membrane; Single-pass type I membrane protein. |
Database References | UniGene: Oar.396 |
Tissue Specificity | Skin. |