Recombinant Sheep CCL4/MIP-1 beta Protein
Beta LifeScience
SKU/CAT #: BLA-2423P
Recombinant Sheep CCL4/MIP-1 beta Protein
Beta LifeScience
SKU/CAT #: BLA-2423P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Sheep |
Synonym | MIP 1 beta Secreted protein G 26 ACT 2 ACT-2 ACT2 AT744.1 AT744.2 C C motif chemokine 4 C C motif chemokine 4 like C C motif chemokine ligand 4 like 1 C C motif chemokine ligand 4 like 2 CC chemokine ligand 4 CC chemokine ligand 4L1 CC chemokine ligand 4L1d2 CC chemokine ligand 4L2 CCL4 CCL4_HUMAN CCL4L ccl4l 1 CCL4L1 Chemokine (C C motif) ligand 4 Chemokine (C C motif) ligand 4 like 1 Chemokine (C C motif) ligand 4 like 1, telomeric Chemokine (C C motif) ligand 4 like 2 Chemokine CC Motif Ligand 4 G 26 G 26 T lymphocyte secreted protein G-26 T-lymphocyte-secreted protein HC21 Immune activation 2 LAG 1 LAG-1 LAG1 Lymphocyte activation gene 1 Lymphocyte activation gene 1 protein Macrophage inflammatory protein 1 beta Macrophage inflammatory protein 1-beta Macrophage inflammatory protein 1b2 MGC104418 MGC126025 MGC126026 MIP-1-beta MIP-1-beta(1-69) MIP-1-beta(3-69) MIP1 beta MIP1B MIP1B1 Monocyte adherence induced protein 5 alpha PAT 744 Protein H400 SCYA2 SCYA4 SCYA4L SCYA4L1 SCYA4L2 SCYQ4L2 Secreted protein G 26 Secreted protein G26 SIS gamma SIS-gamma Small inducible cytokine A4 Small inducible cytokine A4 (homologous to mouse Mip 1b) small inducible cytokine A4-like Small-inducible cytokine A4 T cell activation protein 2 T-cell activation protein 2 |
Description | Recombinant Sheep CCL4/MIP-1 beta Protein was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | APMGSDPPTACCFSYTLRQIPRNFVIDYYETSSLCSQPAVVFQTKKGRQV CANPSEPWVQEYMDDLELN |
Molecular Weight | 8 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |