Recombinant Serine/threonine-Protein phosphatase
Beta LifeScience
SKU/CAT #: BLA-10433P
Recombinant Serine/threonine-Protein phosphatase
Beta LifeScience
SKU/CAT #: BLA-10433P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Bacteriophage lambda |
Accession | P03772 |
Description | Recombinant Serine/threonine-Protein phosphatase was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDL VDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGW FFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFG KPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMY IDTGAVFCGNLTLIQVQGEGA |
Molecular Weight | 25 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | 400,000 U/mg. 400 U/µl, where one unit is defined as the amount of enzyme that hydrolyzes 1 nmole of p-nitrophenyl phosphate per minute at 30°C. Unit definition assays are performed with 50mM p-nitrophenyl phosphate in -PPase buffer, supplemented with 2 mM MnCl2 in a 50 µl reaction. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |