Recombinant Schizosaccharomyces Pombe Mitochondrial Protein Import Protein Mas5 (MAS5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08935P

Greater than 85% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) mas5.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) mas5.
Recombinant Schizosaccharomyces Pombe Mitochondrial Protein Import Protein Mas5 (MAS5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08935P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Schizosaccharomyces Pombe Mitochondrial Protein Import Protein Mas5 (MAS5) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O74752 |
Target Symbol | MAS5 |
Synonyms | mas5; SPBC1734.11; Mitochondrial protein import protein mas5 |
Species | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGHPGVQC |
Expression Range | 1-404aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 51.5 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Probably involved in mitochondrial protein import. Plays a role in microtubule cytoskeleton organization. |
Subcellular Location | Cytoplasm. Nucleus. |
Database References | KEGG: spo:SPBC1734.11 STRING: 4896.SPBC1734.11.1 |
Gene Functions References
- Study identified the S. pombe molecular chaperone proteins Hsp90 and Mas5 as novel regulators of RNAi-dependent heterochromatin assembly. Mutations in the genes encoding these proteins caused derepression of transcriptional silencing and decreases in H3K9me at the pericentromeric heterochromatin region, while having little effect on the subtelomeric heterochromatin, which can be maintained in the absence of RNAi. PMID: 29866182