Recombinant Saccharomyces Cerevisiae Ubiquitin-Like Protein Smt3 (SMT3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03220P
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Ubiquitin-Like Protein Smt3 (SMT3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03220P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Ubiquitin-Like Protein Smt3 (SMT3) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q12306 |
| Target Symbol | SMT3 |
| Synonyms | DmSUMO 1; Small Ubiquitin-like modifier; SMT3; SMT3_YEAST; Ubiquitin like protein of the SUMO family; Ubiquitin like protein SMT3; Ubiquitin-like protein SMT3 |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG |
| Expression Range | 2-98aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 13.1kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Not known; suppressor of MIF2 mutations. |
| Protein Families | Ubiquitin family, SUMO subfamily |
| Database References | KEGG: sce:YDR510W STRING: 4932.YDR510W |
Gene Functions References
- the library of Smt3 mutants represents a valuable resource for further exploring the functions of sumoylation in cellular stress response and other SUMO-dependent pathways. PMID: 28166236
- Ulp2 controls the dynamic range of SUMO chain lengths by trimming them from the distal ends PMID: 25833950
- Cdk1 and SUMO (Smt3) regulate Swe1 stability PMID: 21151918
- the Zn(2+) motif of E1 has a role in SUMO adenylation PMID: 20501649
- there are a broad array of cellular processes regulated by SUMO conjugation PMID: 15590687
- A model is proposed for the positive control of the centromeric pool of Top2p, required for high minichromosome segregation fidelity, by Smt3p modification. PMID: 16204216
