Recombinant Saccharomyces Cerevisiae Tata-Box-Binding Protein (SPT15) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09668P
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Tata-Box-Binding Protein (SPT15) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09668P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Tata-Box-Binding Protein (SPT15) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P13393 |
| Target Symbol | SPT15 |
| Synonyms | SPT15; BTF1; TBP1; YER148W; TATA-box-binding protein; TATA sequence-binding protein; TBP; TATA-binding factor; TATA-box factor; Transcription factor D; Transcription initiation factor TFIID TBP subunit |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | ADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM |
| Expression Range | 2-240aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 28.9kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | General transcription factor that functions at the core of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. |
| Subcellular Location | Nucleus. |
| Protein Families | TBP family |
| Database References | KEGG: sce:YER148W STRING: 4932.YER148W |
Gene Functions References
- Transcription of nearly all yeast RNA polymerase II-transcribed genes is dependent on transcription factor TFIID. PMID: 28918900
- this study identified two SPT15 alleles, nine gene deletions and low concentration of amino acids in the medium that confer enhanced tolerance to acetic acid. PMID: 24761971
- SPT15 confers enhanced tolerance to hyperosmotic stress. PMID: 23709042
- distinct involvement of gene and chromatin regulatory factors in response to DNA damage versus heat shock suggest different implementations of the SAGA and TFIID assembly pathways PMID: 20956559
- showed that Ubp3 was recruited to the GAL1 and HIS3 promoters upon the induction of the respective gene, indicating that protection of promoter-bound Tbp1 by Ubp3 is required for transcriptional activation PMID: 20738257
- Mot1 forms an asymmetric complex with the TBP core domain (TBPc)-DNA complex, contacting DNA both upstream and within the major groove of the TATA box. PMID: 16541100
- These data support an autoinhibitory mechanism in which competition between the N-terminal domain and DNA for the saddle diminishes the DNA binding affinity of the full-length protein. PMID: 17378582
- isolation of extragenic suppressors of one of these spt3 mutations has identified two new spt15 mutations that show allele-specific interactions with spt3 mutations with respect to transcription and the recruitment of TBP to particular promoters PMID: 18073420
