Recombinant Saccharomyces Cerevisiae Serine/Threonine-Protein Kinase Ste11 (STE11)
Beta LifeScience
SKU/CAT #: BLC-04776P
Greater than 85% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Serine/Threonine-Protein Kinase Ste11 (STE11)
Beta LifeScience
SKU/CAT #: BLC-04776P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Serine/Threonine-Protein Kinase Ste11 (STE11) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P23561 |
| Target Symbol | STE11 |
| Synonyms | STE11; YLR362W; L8039.10; Serine/threonine-protein kinase STE11; EC 2.7.11.25 |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Target Protein Sequence | WLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWL |
| Expression Range | 415-712aa |
| Protein Length | Partial |
| Mol. Weight | 33.5 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Serine/threonine protein kinase required for cell-type-specific transcription and signal transduction in yeast. It is thought that it phosphorylates the STE7 protein kinase which itself, phosphorylates the FUS3 and or KSS1 kinases. |
| Protein Families | Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily |
| Database References | KEGG: sce:YLR362W STRING: 4932.YLR362W |
Gene Functions References
- Mechanical stress signal is transmitted via Ste11. PMID: 29187529
- Our results confirm the existence of negative feedback systems targeting the protein levels of Ste11 and Msb2 and also hint at changes in the dissociation rates of intermediate signaling complexes PMID: 25689021
- The Ras-binding-domain-like region in the Ste11 protein that is required specifically for the kinase to function with Ste5 in the mating pathway PMID: 23242997
- Ste11 regulates the FKS2 gene through its substrates and through Mpk1. PMID: 22114773
- DSE1 binds Ste11. The interaction of Dse1 with both Gbeta and Ste11 may be designed to control cross talk between the pheromone and filamentation pathways. PMID: 19820940
- These results demonstrate that the interfacial residues of the dimeric SAM domain of Ste11 are critically involved in its structural stability and binding to the Ste50 SAM domain. PMID: 18092817
