Recombinant Saccharomyces Cerevisiae Phosphoglycerate Mutase 1 (GPM1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01468P

Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Phosphoglycerate Mutase 1 (GPM1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01468P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Saccharomyces Cerevisiae Phosphoglycerate Mutase 1 (GPM1) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P00950 |
Target Symbol | GPM1 |
Synonyms | BPG-dependent PGAM 1 MPGM 1 Phosphoglyceromutase 1 |
Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAAVANQGKK |
Expression Range | 2-247aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 29.5 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also Catalyzes the reaction of EC 5.4.2.4 (synthase), but with a reduced activity. |
Subcellular Location | Cytoplasm. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Mitochondrion intermembrane space. |
Protein Families | Phosphoglycerate mutase family, BPG-dependent PGAM subfamily |
Database References | KEGG: sce:YKL152C STRING: 4932.YKL152C |
Gene Functions References
- at this locus, the intergenic region serves as a focal point of regulatory input, driving antisense expression and mediating the coordinated regulation of YKL151C and GPM1 Together, our findings implicate transcription factors in the joint control of neighboring genes specialized to opposing conditions and the antisense transcripts expressed between them. PMID: 27190003
- Findings strongly suggest a severely impaired growth ability of the GPM1 knock-out mutant, which presents increased transcript levels of genes involved in the pentose phosphate pathway and in the glyoxylate shunt. PMID: 20815084