Recombinant Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase (YNK1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04846P
Greater than 85% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase (YNK1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04846P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase (YNK1) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P36010 |
| Target Symbol | YNK1 |
| Synonyms | YNK1; NDK1; YNK; YKL067W; YKL333; Nucleoside diphosphate kinase; NDK; NDP kinase; EC 2.7.4.6 |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE |
| Expression Range | 1-153aa |
| Protein Length | Full Length |
| Mol. Weight | 19.2 |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage. |
| Subcellular Location | Cytoplasm. Mitochondrion intermembrane space. Note=Localizes predominantly to the cytoplasm. A small fraction is present in the mitochondrial intermembrane space. |
| Protein Families | NDK family |
| Database References | KEGG: sce:YKL067W STRING: 4932.YKL067W |
Gene Functions References
- Crystal structure of Ynk1 provides further insights into the interface and interactions between the dimers and the conserved residues involved in quaternary-structure formation. PMID: 18607079
- The study indicates a novel role for YNK1 in DNA repair in yeast, and suggests an anti-mutator function that may contribute to the metastasis suppressor function of NM23-H1 in humans. PMID: 18983998
