Recombinant Saccharomyces Cerevisiae Neutral Trehalase (NTH1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08227P
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Neutral Trehalase (NTH1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08227P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Neutral Trehalase (NTH1) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P32356 |
| Target Symbol | NTH1 |
| Synonyms | NTH1; NTH; YDR001C; YD8119.07C; Neutral trehalase; EC 3.2.1.28; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | QVNTSQGPVAQGRQRRLSSLSEFNDPFSNAEVYYGPPTDPRKQKQAKPAKINRTRTMSVFDNVSPFKKTGFGKLQQTRRGSEDDTYSSSQGNRRFFIEDVDKTLNELLAAEDTDKNYQITIEDTGPKVLKVGTANSYGYKHINIRGTYMLSNLLQELTIAKSFGRHQIFLDEARINENPVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAK |
| Expression Range | 3-221aa |
| Protein Length | Partial |
| Mol. Weight | 28.8kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Hydrolyzes intracellular trehalose to glucose (Probable). The disaccharide trehalose serves as a storage carbohydrate that is mobilized during nutrient stress (Probable). Regulates the level of trehalose as a protectant for cell integrity during heat stress. |
| Subcellular Location | Cytoplasm. |
| Protein Families | Glycosyl hydrolase 37 family |
| Database References | KEGG: sce:YDR001C STRING: 4932.YDR001C |
Gene Functions References
- EF-hand like motif-containing domain functions as the intermediary through which the 14-3-3 protein modulates the function of the catalytic domain of Nth1 PMID: 24713696
- 14-3-3 proteins are required for both activation of trehalase and phosphorylation of the ser21 and ser83 sites. PMID: 23155055
- Gene disruption of NTH1 and ATH1 increased tolerance to freezing, heat, high-sugar and ethanol concentration. PMID: 19160808
- The behaviour of trehalase mutant strains demonstrates the participation of trehalases Nth1p, Nth2p and Ath1p in the mobilization of intracellular trehalose during growth recovery after saline stress. PMID: 19520725
