Recombinant Saccharomyces Cerevisiae Heat Shock Protein Ssa1 (SSA1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03895P
Greater than 85% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) SSA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) SSA1.
Recombinant Saccharomyces Cerevisiae Heat Shock Protein Ssa1 (SSA1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03895P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Heat Shock Protein Ssa1 (SSA1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P10591 |
| Target Symbol | SSA1 |
| Synonyms | SSA1; YAL005C; Heat shock protein SSA1; Heat shock protein YG100 |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD |
| Expression Range | 443-642aa |
| Protein Length | Partial |
| Mol. Weight | 28.3 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May play a role in the transport of polypeptides both across the mitochondrial membranes and into the endoplasmic reticulum. A functional difference between SSA1 and SSA2 proteins is expected. SSA1 can participate in the ATP-dependent disassembly of clathrin-coated vesicles. |
| Subcellular Location | Cytoplasm. Secreted, cell wall. |
| Protein Families | Heat shock protein 70 family |
| Database References | KEGG: sce:YAL005C STRING: 4932.YAL005C |
Gene Functions References
- Hsp90 (Hsp82) and yeast Hsp70 (Ssa1), directly interact in vitro in the absence of the yeast Hop homolog (Sti1), and identify a region in the middle domain of yeast Hsp90 that is required for the interaction. PMID: 29463764
- Studied deletions of two major chaperone proteins, SSA1 and SSB1, from the HSP70 chaperone network in Sacchromyces cerevisiae. PMID: 25689132
- yeast expressing P417L or P417S as the only copy of Ssa were temperature sensitive and exhibited defects in Ssa1-dependent protein translocation and misfolded protein degradation. PMID: 25913688
- Nearly all interactions remained unchanged or decreased after DNA damage, but 5 proteins increased interactions with Ssa1 and/or Hsp82, including the ribonucleotide reductase (RNR) subunit Rnr4. PMID: 25452130
- The major ubiquitin ligase targeting the superfluous Fas2 subunit to the proteasome is Ubr1. The ubiquitin-conjugating enzymes Ubc2 and Ubc4 assist the degradation process. PMID: 25564609
- Ssa1p and Swa2p cooperatively disassemble yeast clathrin coat baskets PMID: 23913685
- The Hsp70 Chaperone Ssa1 and the AAA-Type ATPase Cdc48 Are Required for Ubr1-Dependent ERAD of Ste6*. PMID: 23988329
- Data indicate that the Hsp70, Ssa1p, facilitates an interaction between a novel misfolded substrate and San1p. PMID: 23653356
- Sis1 and Hsp70 operate sequentially with the quality control E3 ubiquitin ligase Ubr1 to target short-lived green fluorescent protein for degradation. PMID: 23341891
- findings demonstrate that Hsp70 is a proximal sensor for Hsf1-mediated cytoprotection and can discriminate between two distinct environmental stressors PMID: 22809627
- T36 phosphorylation triggers displacement of Ydj1, allowing Ssa1 to bind the G1 cyclin Cln3 and promote its degradation; these results establish an active role for Hsp70 chaperones as signal transducers mediating growth control of G1 cyclin abundance and activity. PMID: 23217712
- the client binding domain of Hsc70 and Ssa1p binds two regions within alpha-Syn similar to a tweezer, with the first spanning residues 10-45 and the second spanning residues 97-102. PMID: 22843682
- a role for Ssa1 in mediating localization of nascent peptide-ribosome-mRNA complexes to the mitochondria PMID: 22138184
- Conformation-dependent Ssa1 hydrophobicity and aggregation play a key role in Ssa1 function. PMID: 20835845
- observations strongly suggest that lysine 339 and its flanking amino acid stretches are involved in the interaction between Ure2p and Ssa1p PMID: 21078122
- Ssa1 plays a general role in elimination of gluconeogenic enzymes. PMID: 20513352
- a potent cochaperone of Ssa1 is Cns1 PMID: 15044454
- Stimulates prion formation and polymer growth by stabilizing misfolded proteins. PMID: 15545639
- Sis1 has a bipartite interaction with Ssa in vivo PMID: 15687271
- Data suggest that Ssa1-21p interferes with disruption of large Sup35p aggregates, which lack or have limited capacity to function as seed, into polymers that function more efficiently as [PSI+] seeds. PMID: 15701791
- characterized the influence of Hsp104 and Ssa1 on the disassembly of Hsp26 x substrate complexes in vitro and in vivo PMID: 15843375
- SSB/SSE and SSA/SSE transiently associate with newly synthesized polypeptides with different kinetics PMID: 16219770
- Sse1 functionally interacts with the Hsp70 chaperones Ssa and Ssb PMID: 16221677
- A structural basis for the regulation of heat-shock proteins in S. cerevisiae is presented. PMID: 16737444
- The introduction of Ssa1p improves secretory proteins in Pichia pastoris secretion 4-7 times. PMID: 16889384
- Jjj1, when overexpressed, is able to partially substitute for the Zuo1:Ssb chaperone machinery by recruiting Ssa to the ribosome, facilitating its interaction with nascent polypeptide chains PMID: 17242366
- Stability experiments revealed that only Hsp70 proteins Ydj1-protected can hydrolyze ATP under prolonged stress. PMID: 17985367
- To determine how the mutations alter Hsp70 we analyzed biochemically the substrate-binding domain (SBD) mutant L483W and the nucleotide-binding domain (NBD) mutants A17V and R34K. PMID: 18706386
- Sse1 exploits a Bag-1-like mechanism to catalyze nucleotide release, which involves opening of the Ssa1 NBD by tilting lobe II. Hsp110 proteins use a unique binding mode to catalyze nucleotide release from Hsp70s by a functionally convergent mechanism PMID: 18948593
- These results suggest that cytosolic Hsp70 plays multiple roles in TBSV replication, such as affecting the subcellular localization and membrane insertion of the viral replication proteins as well as the assembly of the viral replicase. PMID: 19153242
- An in vitro replicase assembly assay with Ssa1p(ts) revealed that functional Ssa1p is required during the replicase assembly process, but not during minus- or plus-strand synthesis of Tombusvirus. PMID: 19748649
