Recombinant Saccharomyces Cerevisiae Gtp-Binding Nuclear Protein Gsp1/Cnr1 (GSP1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11131P

Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Gtp-Binding Nuclear Protein Gsp1/Cnr1 (GSP1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11131P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Saccharomyces Cerevisiae Gtp-Binding Nuclear Protein Gsp1/Cnr1 (GSP1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P32835 |
Target Symbol | GSP1 |
Synonyms | GSP1; CNR1; CST17; YLR293C; L8003.19; GTP-binding nuclear protein GSP1/CNR1; Chromosome stability protein 17; GTPase Ran homolog; Genetic suppressor of PRP20-1 |
Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL |
Expression Range | 2-219aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 30.7 kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1. |
Subcellular Location | Nucleus. |
Protein Families | Small GTPase superfamily, Ran family |
Database References | KEGG: sce:YLR293C STRING: 4932.YLR293C |
Gene Functions References
- Cex1p recruits Rna1p from the cytoplasm to the nuclear pore complex and facilitates Rna1p activation of the GTPase activity of Gsp1p by enabling Rna1p to gain access to Gsp1p-GTP bound to the Los1p-tRNA-Gsp1p-GTP export complex. PMID: 22008473
- Study proved that the additional beta-wedge in Prp20p is essential for the interaction between Prp20p and Gsp1p. PMID: 21093592
- Thus, the Gtr1p-Gtr2p cycle was suggested to regulate the Ran cycle through Yrb2p. PMID: 16143306
- Results suggest that the GSP1 pathway could regulate proper telomeric function in yeast through Sir4p. PMID: 16956377