Recombinant Saccharomyces Cerevisiae Glutathione Peroxidase-Like Peroxiredoxin 2 (GPX2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01971P
Greater than 85% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Glutathione Peroxidase-Like Peroxiredoxin 2 (GPX2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01971P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Glutathione Peroxidase-Like Peroxiredoxin 2 (GPX2) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P38143 |
| Target Symbol | GPX2 |
| Synonyms | Glutathione peroxidase homolog 2 (GPx 2) |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK |
| Expression Range | 1-162aa |
| Protein Length | Full Length |
| Mol. Weight | 23.4 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Glutathione peroxidase-like protein that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress. Plays an important role in the oxidative stress-induced response in the presence of Ca(2+). Has peroxidase activity using preferentially thioredoxin as a reducing power. The redox state of the mitochondrial GPX2 is regulated by TRX1 and TRX2 (cytoplasmic thioredoxin), and by TRX3 (mitochondrial matrix thioredoxin). Involved in sporulation. |
| Subcellular Location | Cytoplasm. Nucleus. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Mitochondrion inner membrane; Peripheral membrane protein; Matrix side. |
| Protein Families | Glutathione peroxidase family |
| Database References | KEGG: sce:YBR244W STRING: 4932.YBR244W |
Gene Functions References
- Gpx2 was found to exist in the cytoplasm and mitochondria. PMID: 21763276
- determination that Gpx2 codes for an atypical 2-Cys peroxiredoxin and is likely to play an important role in the protection of cells from oxidative stress in the presence of Ca2+ PMID: 16251189
