Recombinant Saccharomyces Cerevisiae Eukaryotic Translation Initiation Factor 5A-1 (HYP2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09090P
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Eukaryotic Translation Initiation Factor 5A-1 (HYP2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09090P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Eukaryotic Translation Initiation Factor 5A-1 (HYP2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P23301 |
| Target Symbol | HYP2 |
| Synonyms | HYP2; TIF51A; YEL034W; SYGP-ORF21Eukaryotic translation initiation factor 5A-1; eIF-5A-1; Hypusine-containing protein HP2; eIF-4D |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD |
| Expression Range | 2-157aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 33.0kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell. |
| Subcellular Location | Cytoplasm. Note=Concentrates in the perinuclear region. |
| Protein Families | EIF-5A family |
| Database References | KEGG: sce:YEL034W STRING: 4932.YEL034W |
Gene Functions References
- the ability of eIF5A from tif51A-4 to bind to the ribosome while potentially blocking physical interaction with P-tRNA could explain its dominant negative phenotype. PMID: 27388480
- Data show that translation elongation factor eIF-5A (eIF5A) requirement for polyproline synthesis is imposed by proline, not by tRNAPro. PMID: 28637321
- eIF5A facilitates translation termination globally and promotes the elongation of many non polyproline-specific tripeptide sequences. PMID: 28549188
- eIF5A strongly promotes the translation of the stalling sequences identified by profiling and increases the rate of peptidyl-tRNA hydrolysis more than 17-fold. PMID: 28392174
- tRNA. These findings would support a model whereby eIF-5A stimulates peptide bond formation on polyproline-stalled ribosomes by stabilizing and orienting the CCA-end of the P-tRNA PMID: 26715760
- Our results identify eIF5A as a novel and essential regulator of yeast mating through formin translation. PMID: 24923804
- the eIF5A dimer is L-shaped and superimposable on the tRNA(Phe) tertiary structure, analogously to the EF-P monomer. PMID: 22945904
- Pkc1 and eIF5A are involved in establishing actin polarity, which is essential for bud formation and G1/S transition in S. cerevisiae. PMID: 16157662
- data revealed important structural features of eIF5A that are required for its vital role in cell viability and underscored an essential function of eIF5A in the translation step of gene expression. PMID: 18341589
- study shows that hypusinated yeast eIF5A exists as a homodimer, that dimerization requires hypusine and is RNA dependent PMID: 19120453
- Taken together, these results not only reinforce a role for eIF5A in translation but also strongly support a function for eIF5A in the elongation step of protein synthesis. PMID: 19338753
- eIF5A promotes translation elongation PMID: 19424157
