Recombinant Saccharomyces Cerevisiae Cytosine Deaminase (FCY1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11031P
Greater than 85% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Cytosine Deaminase (FCY1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11031P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Cytosine Deaminase (FCY1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q12178 |
| Target Symbol | FCY1 |
| Synonyms | FCY1; YPR062W; YP9499.17Cytosine deaminase; EC 3.5.4.1; Cytosine aminohydrolase |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIGE |
| Expression Range | 1-158aa |
| Protein Length | Full Length |
| Mol. Weight | 25.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Catalyzes the hydrolytic deamination of cytosine to uracil or 5-methylcytosine to thymine. Is involved in the pyrimidine salvage pathway, which allows the cell to utilize cytosine for pyrimidine nucleotide synthesis. |
| Subcellular Location | Cytoplasm. Nucleus. |
| Protein Families | Cytidine and deoxycytidylate deaminase family |
| Database References | KEGG: sce:YPR062W STRING: 4932.YPR062W |
Gene Functions References
- Cytosine deaminase residue glutamate64 plays a critical role in the activation of anticancer prodrug 5-fluorocytosine, indicating importance not only for the deamination reaction but also for binding of the substrate. PMID: 22208667
