Recombinant Saccharomyces Cerevisiae Cell Wall Mannoprotein Cis3 (CIS3) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00475P
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Cell Wall Mannoprotein Cis3 (CIS3) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00475P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Cell Wall Mannoprotein Cis3 (CIS3) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P47001 |
| Target Symbol | CIS3 |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | DVISQIGDGQVQATSAATAQATDSQAQATTTATPTSSEKISSSASKTSTNATSSSCATPSLKDSSCKNSGTLELTLKDGVLTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITEDGYLALGDSDVFYQCLSGNFYNLYDQNVAEQCSAIHLEAVSLVDC |
| Expression Range | 65-227aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 24.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Component of the outer cell wall layer. Required for stability of the cell wall and for optimal growth. Required for resistance against several antifungal and cell wall-perturbing agents. |
| Subcellular Location | Secreted, cell wall. Note=Covalently attached to the cell wall. Localizes predominantly on the surface of growing buds. |
| Protein Families | PIR protein family |
| Database References | KEGG: sce:YJL158C STRING: 4932.YJL158C |
