Recombinant Saccharomyces Cerevisiae Actin (ACT1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00177P
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Actin (ACT1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00177P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Saccharomyces Cerevisiae Actin (ACT1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Activity | Not tested. |
| Uniprotkb | P60010 |
| Target Symbol | ACT1 |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF |
| Expression Range | 1-375aa |
| Protein Length | Full Length |
| Mol. Weight | 49.1 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. |
| Subcellular Location | Cytoplasm, cytoskeleton. |
| Protein Families | Actin family |
| Database References | KEGG: sce:YFL039C STRING: 4932.YFL039C |
Gene Functions References
- Act1 protein affects tombusvirus recombination in yeast . PMID: 26773384
- Using multi-color total internal reflection fluorescence microscopy, the study shows that Crn1 enhances Cof1-mediated severing by accelerating Cof1 binding to actin filament sides. PMID: 26299936
- Translation elongation factor 1A mutants with altered actin bundling activity show reduced aminoacyl-tRNA binding and alter initiation via eIF2alpha phosphorylation. PMID: 24936063
- Heat shock-induced processing of actin assembly protein Lsb1 is involved in prion inheritance. PMID: 25143386
- Data suggest that a glycolytic multi-enzyme complex assembles in cytoplasm of S. cerevisiae in association with F-actin (filamentous actin) but not in association with G-actin (monomeric globular actin). PMID: 23763840
- Lsb1 and/or Lsb2 full-length proteins inhibit Las17-mediated actin polymerization PMID: 23577202
- data suggest that the R256H actin mutation alters filament conformation resulting in filament instability and misregulation by formin PMID: 22753406
- analysis of the molecular mechanism of plasma membrane-actin cytoskeleton coupling mediated by cooperative action of epsin Ent1 and the HIP1R homolog Sla2 in yeast Saccharomyces cerevisiae PMID: 22927393
- Data suggest that the region surrounding residue 204 is involved in interactions that change depending on the phosphorylation state of the bound nucleotide that might reflect different conformations of F-actin subunits. PMID: 19935871
- Vid24p and Sec28p are present at actin patches during glucose starvation. PMID: 19892709
- Two recessive mutations, act1-301 in the actin gene and sla2-82 in a gene involved in cortical actin patch assembly, were identified. PMID: 16547104
- An unanticipated role for Aip1 and cofilin in promoting rapid turnover of yeast actin cables was revealed. PMID: 16611742
- The stabilization of the actin cytoskeleton caused by deletion of Sla1p or End3p leads to hyperactivation of the Ras signaling pathway. PMID: 16914733
- Study found 208 genes that have deleterious complex haploinsufficient (CHI) interactions with actin, including several actin-binding protein genes, and nearly half of the CHI genes have defects in actin organization when deleted. PMID: 17167106
- In a single ATP-driven cycle, PLP2-CCT-ACT1 complexes yield 30-fold more native actin than CCT-ACT1 complexes. PMID: 19501098
