Recombinant Saccharomyces Cerevisiae 26S Proteasome Regulatory Subunit Rpn13 (RPN13) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08947P

Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae 26S Proteasome Regulatory Subunit Rpn13 (RPN13) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08947P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Saccharomyces Cerevisiae 26S Proteasome Regulatory Subunit Rpn13 (RPN13) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O13563 |
Target Symbol | RPN13 |
Synonyms | RPN13; DAQ1; YLR421C; 26S proteasome regulatory subunit RPN13; Proteasome non-ATPase subunit 13 |
Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | SMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD |
Expression Range | 2-156aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 33.8kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Component of the 19S cap proteasome complex which acts as a regulatory subunit of the 26S proteasome, involved in the ATP-dependent degradation of ubiquitinated proteins. |
Subcellular Location | Cytoplasm. Nucleus. |
Protein Families | RPN13 family |
Database References | KEGG: sce:YLR421C STRING: 4932.YLR421C |
Gene Functions References
- Inherent asymmetry in the 26S proteasome is defined by the ubiquitin receptor RPN13. PMID: 24429290
- On the basis of the mutual positions of Rpn10 and Rpn13, we propose a model for polyubiquitin binding to the 26S proteasome PMID: 22215586
- Rpn13 protein is involved in the efficient recognition of 26S proteasome for the proteolysis of ubiquitinated Gcn4p. PMID: 17499717
- identification of a new ubiquitin receptor, Rpn13/ARM1, a known component of the proteasome PMID: 18497817