Recombinant Receptor-Type Tyrosine-Protein Phosphatase Zeta (PTPRZ1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04681P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PTPRZ1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PTPRZ1.
Recombinant Receptor-Type Tyrosine-Protein Phosphatase Zeta (PTPRZ1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04681P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Receptor-Type Tyrosine-Protein Phosphatase Zeta (PTPRZ1) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P23471 |
| Target Symbol | PTPRZ1 |
| Synonyms | 3F8 chondroitin sulfate proteoglycan; 3H1 keratan sulfate proteoglycan; HPTPZ; HPTPzeta; Phosphacan; Protein tyrosine phosphatase receptor type Z polypeptide 2; Protein tyrosine phosphatase, receptor type, Z polypeptide 1; Protein tyrosine phosphatase, receptor type, zeta polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2; PTP-ZETA; PTP18; PTPRZ; PTPRZ_HUMAN; Ptprz1; PTPZ; R PTP zeta 2; R-PTP-zeta; R-PTP-zeta-2; Receptor type tyrosine phosphatase beta/zeta; Receptor-type tyrosine-protein phosphatase zeta; RPTP-BETA; RPTPB; RPTPbeta |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY |
| Expression Range | 36-300aa |
| Protein Length | Partial |
| Mol. Weight | 32.1 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades. |
| Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein. Secreted.; [Isoform 2]: Secreted. |
| Protein Families | Protein-tyrosine phosphatase family, Receptor class 5 subfamily |
| Database References | HGNC: 9685 OMIM: 176891 KEGG: hsa:5803 STRING: 9606.ENSP00000377047 UniGene: PMID: 28504721 |
