Recombinant Rattus Norvegicus Comm Domain-Containing Protein 5 (COMMD5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07682P

Greater than 85% as determined by SDS-PAGE.
Recombinant Rattus Norvegicus Comm Domain-Containing Protein 5 (COMMD5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07682P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rattus Norvegicus Comm Domain-Containing Protein 5 (COMMD5) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9ERR2 |
Target Symbol | COMMD5 |
Synonyms | Hypertension-related calcium-regulated gene protein |
Species | Rattus norvegicus (Rat) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD |
Expression Range | 2-224aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 28.2 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis. Down-regulates activation of NF-kappa-B. |
Subcellular Location | Nucleus. |
Database References | |
Tissue Specificity | Expressed in the zona fasciculata and medulla of the adrenal gland; expressed in kidney proximal tubules. Basal expression is higher in hypertensive than in normotensive animals. |
Gene Functions References
- Hcarg localizes to the rat chromosome 7 between the markers Mit3 and Mit4. We identified a BglII RFLP between BN.lx and SHR rats. PMID: 11871861
- HCaRG regulates renal epithelial cell growth and differentiation causing G(2)M cell cycle arrest PMID: 12620924
- data support a role for HCaRG in kidney repair after injury through its effect on renal cell migration and TGF-alpha secretion PMID: 16033922
- The up-regulation of HCaRG may be one of the mechanisms underlying the chemopreventive effect of rosiglitazone in gastric cancer. PMID: 18949406