Recombinant Rat Vesicular Glutamate Transporter 2 (SLC17A6) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-06452P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Vesicular Glutamate Transporter 2 (SLC17A6) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-06452P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Vesicular Glutamate Transporter 2 (SLC17A6) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9JI12 |
| Target Symbol | SLC17A6 |
| Species | Rattus norvegicus (Rat) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS |
| Expression Range | 499-582aa |
| Protein Length | Partial |
| Mol. Weight | 17.1 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas. |
| Subcellular Location | Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome. |
| Protein Families | Major facilitator superfamily, Sodium/anion cotransporter family, VGLUT subfamily |
| Database References | KEGG: rno:84487 STRING: 10116.ENSRNOP00000022383 UniGene: PMID: 29650024 |
