Recombinant Rat VEGFC Protein
Beta LifeScience
SKU/CAT #: BLA-2259P
Recombinant Rat VEGFC Protein
Beta LifeScience
SKU/CAT #: BLA-2259P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | O35757 |
Synonym | Flt 4L Flt4 ligand FLT4 ligand DHM Flt4-L Flt4L Vascular endothelial growth factor C Vascular endothelial growth factor related protein Vascular endothelial growth factor-related protein VEGF C VEGF-C Vegfc VEGFC_HUMAN VRP |
Description | Recombinant rat VEGFC Protein was expressed in Insect cells. It is a Full length protein |
Source | Insect cells |
AA Sequence | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH |
Purity | >90% SDS-PAGE.Purity >90% by SDS-PAGE and visualised by silver stain.Product is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGFC by a Ser residue. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | This product is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT -4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR.Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells (PAE/FLT -4 cells). The ED50 for this effect is typically 150-300 ng/ml. Inactive in the vascular permeability assay. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |