Recombinant Rat Vascular Endothelial Growth Factor A (VEGFA) Protein (His)

Name: Recombinant Rat Vascular Endothelial Growth Factor A (VEGFA) Protein (His)
Brand: Beta LifeScience
SKU: BLC-09296P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Vascular Endothelial Growth Factor A (VEGFA) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P16612
Target Symbol	VEGFA
Synonyms	Vegfa; Vegf; Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Expression Range	27-214aa
Protein Length	Full Length of Mature Protein
Mol. Weight	26.1kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development.
Subcellular Location	Secreted.
Protein Families	PDGF/VEGF growth factor family
Database References	KEGG: rno:83785 STRING: 10116.ENSRNOP00000026637 UniGene: PMID: 29486133 the epigenetic mechanisms involved in the physical exercise-mediated induction of VegfA expression, were examined. PMID: 27975171 Our data suggest that activation of the GPR91-ERK1/2-C/EBP beta (c-Fos, HIF-1a) signaling pathway plays a tonic role in regulating VEGF transcription in rat retinal ganglion cells. PMID: 28374767 present results suggested that pathologically high cyclic stretch induces the shuttling of SRSF1 which results in the secretive pattern splicing of VEGFA and finally contributes to the proliferation of vascular smooth muscle cells. PMID: 29974845 Results indicate that vascular endothelial growth factor (VEGF) is a vital important factor that contributes to the small-airway remodelling in a rat model of Chronic obstructive pulmonary disease through promoting angiogenesis, which mainly depend on the specific binding between VEGF and VEGF receptor 1 and can be effectively attenuated by sunitinib. PMID: 28117425 150-kDa oxygen-regulated protein (ORP150) levels were significantly increased in rat retinas after induction of diabetes. Vascular endothelial growth factor (VEGF) and the pro-inflammatory cytokines interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha) induced upregulation of ORP150 in HRMEC. PMID: 29098793 Expression of vascular endothelial growth factor in cardiac repair: Signaling mechanisms mediating vascular protective effects PMID: 29462681 VEGF-A expression in soft tissues repaired by shockwave therapy PMID: 29921384 While the mRNA expression of the proangiogenic factors VEGF, transforming growth factor-beta1 (TGF-beta1), and adrenomedullin dropped at 0 h post-hypoxia compared to normoxic control, no changes were detected at the protein level, showing an impaired response of these proangiogenic factors to hypoxia in the aged striatum PMID: 28501895 Kisspeptin-10 prevents the increased vascular permeability of ovarian hyperstimulation syndrome by the activation of KISS1R and the inhibition of VEGF. PMID: 28676533 The results indicate that VEGF promotes endothelial progenitor cell differentiation and vascular repair through Cx43. PMID: 29065929 The results obtained in the study revealed that down-regulation of VEGF by RNAi could be a novel target approach for the treatment of failure (UFF) in rats with peritoneal dialysis. PMID: 28733472 VEGF165 induces differentiation of hair follicle stem cells into endothelial cells and plays a role in in vivo angiogenesis. PMID: 28244687 Enhanced neuroprotective efficacy of bone marrow mesenchymal stem cells co-overexpressing BDNF and VEGF in a rat model of cardiac arrest-induced global cerebral ischemia PMID: 28492549 this is the first report describing the use of novel polymeric gene carriers for the delivery of VEGF gene to DA neurons with improved transfection efficiency. Finally, the study will lead to a significant advancement in the field of non-viral Parkinson's Disease gene therapy treatment. PMID: 28025049 the results indicate that, Osx-overexpression promotes ADSCs' osteogenesis both in vitro and in vivo, which could be enhanced by release of VEGF. PMID: 28107808 Following IL-1beta (50mug/kg ip.) administration, a higher serum IL-1beta level was detected in females than in males. In male rats, IL-1beta decreased BDNF mRNA in all the brain structures, except for the pituitary, and VEGF mRNA in the amygdala. PMID: 27744091 VEGF knockdown can enhance chondrogenesis and prevent osteoarthritis progression. PMID: 27164955 Here we report for the first time the expression of a rare and unusually potent splice variant, VEGF 111 , in vivo in mammals. Our discovery of VEGF 111 in the uterus of both a eutherian (rat) and a marsupial (fat-tailed dunnart) suggests that the splice variant may be common to all mammals PMID: 27722773 Data indicate vascular endothelial growth factor A (VEGFA) as a target gene of miR-200b. PMID: 28122882 Our results suggest that hUCMSCs can promote ovarian expression of HGF, VEGF, and IGF-1 through secreting those cytokines, resulting in improving ovarian reserve function and withstanding ovarian senescence. PMID: 28279229 We demonstrate that a fine balance of VEGF and angiopoietin signaling is required for the formation of a functional vascular network. PMID: 27868196 results indicate that the paracrine factor, VEGF, derived from transplanted BM-MSCs, regulated the expression of miRNAs such as miRNA-23a and miRNA-92a and exerted anti-apoptotic effects in cardiomyocytes after MI PMID: 28662151 VEGF expression increased markedly in the cerebellum and mildly in the occipital lobe following up to 4 weeks of exposure to 20-ppm methylmercury. VEGF expression was detected mainly in astrocytes of the blood brain barrier. Intravenous administration of anti-VEGF neutralizing antibody mildly reduced the rate of hind-limb crossing signs observed in MeHg-exposed rats. PMID: 28118383 Overexpressed long non-coding RNA (lncRNA) ANRIL upregulates vascular endothelial growth factor (VEGF) and promotes angiogenesis by activating NF-kappa B (NF-kappaB) signaling pathway in diabetes mellitus (DM) combined with cerebral infarction (DM + CI) rats. PMID: 28060742 Vitexicarpine increased rats' survival time and decreased serum alpha-fetoprotein as well as it ameliorated fibrosis and massive hepatic tissue breakdown. It attenuated hepatocellular carcinoma-induced protein and gene expression of vascular endothelial growth factor PMID: 28651490 Knockdown of hepatic VEGF decreases hepatic sdf1 expression and plasma sdf1 levels. PMID: 26939868 XBP1 regulates VEGF-mediated cardiac angiogenesis. PMID: 27133203 a novel rodent model to reproduce much of the known phenotype of CTEPH, including the pivotal pathophysiological role of impaired vascular endothelial growth factor-dependent vascular remodeling, is reported. PMID: 28183533 VEGF treatment increases expression of HGF in vitro and in vivo and that, based on a series of integrative studies, we suggest that the effects of VEGF are mediated through downstream HGF signaling. PMID: 27036872 MiR-21 exerts protective effects on endothelial injury through the PTEN/VEGF pathway after acute myocardial infarction. PMID: 27708252 Chemerin and VEGF play important roles in diabetic nephropathy. PMID: 27612613 Vegf expression is increased in brain from ischemic rats following treadmill exercise. PMID: 27747480 these results suggested that miRNA-29a suppresses cardiac fibrosis and fibroblasts proliferation via targeting VEGF-A/MAPK signal pathway implicating that miRNA-29a might play a role in the treatment of cardiac fibrosis. PMID: 27060017 Data suggest that a vascular endothelial growth factor (VEGF) signaling defect possibly plays an important role in defective embryonic airway branching. PMID: 27372649 the inhibitory effect of miR1405p on angiogenesis was attenuated by the overexpression of VEGFA. PMID: 27035554 we aimed to investigate the effect on angiogenesis of endoglin and VEGF expression in 1, 2-dimethylhydrazine dihydrochloride (DMH)-induced rat colon carcinogenesis and evaluated the implementation of COX2 inhibitors for molecular targets on tumor considering the above-mentioned mechanisms. PMID: 27466499 This study demonstrated that vegf increases in male rat with aneurysmal subarachnoid hemorrhage. PMID: 26923576 This study demonstrates that hyperthyroidism may have an effect on the development of rat adrenal glands mediated by VEGF expression, angiogenesis, and apoptosis. PMID: 26708182 This PHD-2-mediated transcriptional activation may be important for regulating VEGF expression through HIF-1a signaling in LCs during corpus luteum development in mammals. PMID: 26681021 Results indicate that chronic stress enhances vulnerability of brain-derived neurotrophic factor and vascular endothelial growth factor response to neuroinflammation. PMID: 26396035 Identify a mechanism of VEGF overexpression in liver and mesentery that promotes pathologic, but not physiologic, angiogenesis, via sequential and nonredundant functions of CPEB1 and CPEB4. PMID: 26627607 The increased level of VEGF expression in the nicotine-treated group may have affected endothelial cell apoptosis PMID: 27363062 TP53, BCL-2, and VEGFA genes may participate in the proliferation of esophagus cancer cells in a synergistic manner PMID: 26439224 results indicate OVX may induce 3-D capillary regression in soleus muscle through an imbalance between VEGF-A and TSP-1 expression, possibly associated with decreased exercise tolerance in ovariectomized rats. PMID: 26092525 PHD2-mediated transcriptional activation may be one of the mechanisms regulating VEGF expression in luteal cells during mammalian corpus luteum development. PMID: 25975603 Cardiomyocyte VEGF activates EC Notch signaling, facilitating GPIHBP1-mediated translocation of LPL across EC and regulating LPL-derived fatty acid delivery to the cardiomyocytes. PMID: 26586663 Expression in control and blank groups was similar at 3 and 6 months. Atorvastatin can inhibit VEGI and vascular endothelial growth factor expression to protect rats from diabetic retinopathy PMID: 26125742 VEGF is implicated in the pathogenesis of inflammation after electrical burns. PMID: 25466960 No significant differences were noted in the expression of VEGF in rat tympanic membrane perforation. PMID: 25920966

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Rat Vascular Endothelial Growth Factor A (VEGFA) Protein (His)

Recombinant Rat Vascular Endothelial Growth Factor A (VEGFA) Protein (His)

Product Overview

Target Details

FAQs