Recombinant Rat Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04658P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04658P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P49616 |
| Target Symbol | PLAUR |
| Synonyms | PlaurUrokinase plasminogen activator surface receptor; U-PAR; uPAR; CD antigen CD87 |
| Species | Rattus norvegicus (Rat) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG |
| Expression Range | 25-299aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 34.1 kDa |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. |
| Subcellular Location | [Isoform 1]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 2]: Secreted. |
| Database References | KEGG: rno:50692 STRING: 10116.ENSRNOP00000063960 UniGene: PMID: 24935436 |
