Recombinant Rat Transient Receptor Potential Cation Channel Subfamily A Member 1 (TRPA1) Protein (His&Myc)

Name: Recombinant Rat Transient Receptor Potential Cation Channel Subfamily A Member 1 (TRPA1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00604P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Transient Receptor Potential Cation Channel Subfamily A Member 1 (TRPA1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q6RI86
Target Symbol	TRPA1
Synonyms	(Ankyrin-like with transmembrane domains protein 1)(Wasabi receptor)
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	IGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDI
Expression Range	960-1125aa
Protein Length	Partial
Mol. Weight	27.3 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor-activated non-selective cation channel involved in pain detection and possibly also in cold perception, oxygen concentration perception, cough, itch, and inner ear function. Shows 8-fold preference for divalent over monovalent cations. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of irritants, such as allylthiocyanate (AITC) found in mustard oil or wasabi, cinnamaldehyde, diallyl disulfide (DADS) from garlic, and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as an ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana. Is activated by a large variety of structurally unrelated electrophilic and non-electrophilic chemical compounds. Electrophilic ligands activate TRPA1 by interacting with critical N-terminal Cys residues in a covalent manner, whereas mechanisms of non-electrophilic ligands are not well determined. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	Transient receptor (TC 1.A.4) family
Database References	KEGG: rno:312896 STRING: 10116.ENSRNOP00000009874 UniGene: PMID: 29777700 Upregulated substance P (SP) and TRPA1 in the dorsal root ganglion and stomach and increased serum and gastric mucosa SP levels may contribute to stress-induced acute gastric mucosal lesions. PMID: 29428952 IL-6 synthesis and secretion were connected to acute Peritoneal dialysis fluid exposure, and this response was triggered by TRPA1 receptors, possibly located to non-neuronal cells. PMID: 28698251 The TRPA1 channel is activated by noxious cold, reactive oxygen species and mechanical stimuli and is expressed in small- and medium-sized nociceptive neurons of the dorsal root, trigeminal, and nodose ganglia. PMID: 28640016 TRPA1 receptors on nociceptors are active in incised fascia and muscle but this is not evident in incised skin. Even though endogenous TRPA1 agonists like ROS and H2O2 were increased in both incised skin and muscle, those in skin do not contribute to nociceptive behaviors. PMID: 28103292 Tetracaine facilitated spontaneous l-glutamate release from nerve terminals by activating TRPA1 channels in the substantia gelatinosa (SG), resulting in an increase in the excitability of SG neurons. TRPA1 activation was not specific to amide-type or ester-type local anesthetics (LAs). The facilitatory action of LAs may be involved in pain occurring after recovery from spinal anesthesia. PMID: 28017670 expression in distal colonic mucosa may be involved restored colonic transit after pelvic nerve denervation PMID: 28032561 High TRPA1 expression is associated with neuropathic pain. PMID: 28370084 TRPA1 functions as a sensor that is activated by reactive aldehydes and is modulated when intracellular changes in oxygen levels occur. PMID: 27748654 data suggest that cardamonin is a selective TRPA1 antagonist, providing novel insight into the target of its anti-nociceptive activity. PMID: 27589700 Our results indicate that cannabinoids can enhance the mechanosensitivity of TG endings in the inner walls of anterior chambers of rat eye via TRPA1 activation. PMID: 27752892 TRPA1-channels involvement in the activation of bladder DSM contraction of normal rats and rats with experimental diabetes. Our data show that diabetes affects TRPA1-dependent mechanisms of DSM contractility mainly via an overall inflammatory reaction associated with diabetes, which leads to an enhanced functional coupling between the tachykinin and prostanoid systems. PMID: 26935999 Spinal TRPA1 may contribute to facilitation of morphine antinociceptive tolerance. PMID: 26922555 Report activation of TRPA1 by o-chlorobenzylidene malononitrile as model of neuropathic pain. PMID: 26046936 Meningeal blood flow is controlled by H2S-NO crosstalk activating a HNO-TRPA1-CGRP signalling pathway PMID: 25884403 TRPA1 expression via activation of p38 MAPK in DRG neurons, at least in part, contributes to the development of oxaliplatin-induced acute cold hyperalgesia. PMID: 26567040 The results of this study showed that TRPA1 in muscle afferents plays an important role in the development of acute mechanical hypersensitivity and in the maintenance of persistent muscle pain and hypersensitivity. PMID: 26393428 H2S has both inhibitory and excitatory effects by opening KATP and TRPA1 channels, respectively, in RIN14B cells, suggesting potential bidirectional modulation of secretory functions. PMID: 26172081 The TRPA1 channel mediates the analgesic action of dipyrone and pyrazolone derivatives PMID: 25765567 TRPA1 appears to be localized not only at presynaptic terminals on SG neurons, enhancing glutamate release PMID: 25896791 Results suggested that TRPA1 mechanisms play a significant role in the sensitization of ocular-responsive trigeminal brainstem neurons in this model for tear deficient dry eye PMID: 25639234 TRPA1 is a major mediator of the proinflammatory/proalgesic actions of aromatase inhibitors PMID: 25484020 TRPA1 channel has a role in activation of mechanosensitive afferent nerve activities of both Adelta- and C-fibers of the rat bladder, although its role in a physiological condition might be small. PMID: 23784920 TRPA1 activation by H2O2 mediates the entire inflammatory response in an acute gout attack rodent model PMID: 24780252 The results suggest that TRPA1 channels in rat odontoblastgs are involved in sensing membrane stretching and low-temperature stimulation. PMID: 24358160 TRPA1 is essential to the in vivo nociceptive effects induced by one of the most important mediators of inflammatory pain, prostaglandin E. PMID: 24607781 Hydrogen sulfide directly activates TRPA1 and its increment of diffusion into cells may be involved in the potentiation of TRPA1 activation under external acidic conditions. PMID: 23873754 the actions of cyclooxygenase metabolites are mediated through the functioning of the TRPV1 and TRPA1 receptors PMID: 23832015 TRPA1 might be involved in the pathophysiological process of ventilator-induced lung injury PMID: 23846257 Cold activates rat and mouse TRPA1 but not human or rhesus monkey TRPA1. A single residue within the S5 transmembrane domain (G878 in rodent but V875 in primate) accounts for the difference in cold sensitivity. PMID: 24071625 Reactive oxygen species enhance synaptic transmission in dorsal horn cells through TRPA1 (and TRPV1) channel activation. PMID: 23707800 Data suggest spinal TRPA1 channels in posterior horn cells are involved in mechanical pain hypersensitivity, in increased cutaneous blood flow due to antidromic activation of nociceptive nerves, and in pronociceptive action of dynorphin A. PMID: 23959730 Monosodium urate injection increases tissue H2 O2 , thereby stimulating TRPA-1 on sensory nerve endings to produce inflammation and nociception. PMID: 23918657 H2S induces a nonspecific sensitizing effect on capsaicin-sensitive lung vagal fibers to both chemical and mechanical stimulation in rat lungs, which appears mediated through an action on the TRPA1 receptors. PMID: 23842678 Gene silencing of TRPA1 completely prevents carrageenan-induced hyperalgesia and significantly reduces TRPA1 expression in dorsal root ganglia cells. PMID: 23098993 The results of this study demonstrated that TRPA1 mediates some of the key inflammatory mechanisms, suggesting a key role of this receptor in pain and inflammation. PMID: 23521647 Factors that stimulate TRPA1 channels expand Ca2+ signal-effector coupling at discrete sites along the endothelium to evoke graded cerebral artery vasodilation. PMID: 22928941 TRPA1 channel in the skin contributes to sustained as well noxious mechanical stimulus-evoked postoperative pain PMID: 22588108 Hydrogen sulfide activates TRPA1 receptors causing CGRP release from sensory nerves of rat tracheae. PMID: 22721614 TRPA1 is functionally expressed primarily by IB4-binding, non-peptidergic mouse and rat sensory neurons PMID: 23133534 Trpa1 expression in female Wistar rats varied with postnatal age, tissue (urothelium, detrusor, or whole bladder), and duration (4-h, 48-h, or chronic) of cyclophosphamide-induced cystitis. PMID: 22865090 TRPA1 contributes to cold-induced contractions of the rat colon smooth muscle, and the mechanism involves the PLC/IP(3)/Ca(2+) pathway. PMID: 20717636 TRPA1 is expressed on a substantial fraction of dural afferents, and activation of meningeal TRPA1 produces behaviors consistent with those observed in patients during migraine attacks. PMID: 22809691 Methylglyoxal activates nociceptors through transient receptor potential channel A1 (TRPA1): a possible mechanism of metabolic neuropathies. PMID: 22740698 Study propose that endogenous and exogenous ligands of TRPA1 cause Ca(2) influx and induce basal insulin release and that TRPA1-mediated depolarization acts synergistically with K(ATP) channel blockade to facilitate insulin release. PMID: 22701540 The results indicate that warmth suppresses and desensitizes damage-sensing ion channel TRPA1. PMID: 22458587 TRPA1 channel exerts an important role in the pathogenesis of peripheral diabetic neuropathy. Blocking the TRPA1 channel provides a selective disease-modifying treatment of PDN. PMID: 22133672 The electrophysiological characteristics of TRPA1 suggest that it might play a unique role in nociception. PMID: 21653898 These findings that a short-term application of artemin inhibits the TRPA1 channel's activity and the sequential pain behaviors suggest a role of artemin in regulation of sensory neurons. PMID: 21619614 Data show that the TRPA1 activation and upregulation seem to exert an important role in overactive bladder following spinal cord injury. PMID: 21367919

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.