Recombinant Rat Synaptophysin (SYP) Protein (His)

Name: Recombinant Rat Synaptophysin (SYP) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02021P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins, Recombinant transmembrane proteins – fall special offers

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Synaptophysin (SYP) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P07825
Target Symbol	SYP
Synonyms	(Major synaptic vesicle protein p38)
Species	Rattus norvegicus (Rat)
Expression System	in vitro E.coli expression system
Tag	N-10His
Target Protein Sequence	MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM
Expression Range	1-307aa
Protein Length	Full Length
Mol. Weight	34.8 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.
Subcellular Location	Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Protein Families	Synaptophysin/synaptobrevin family
Database References	KEGG: rno:24804 STRING: 10116.ENSRNOP00000013724 UniGene: PMID: 29545098 Dexamethasone treatment significantly affects both GAP-43 and synaptophysin protein expression in the hippocampus of aged rats. PMID: 28801169 Synaptophysin cerebellar cortex expression was significantly reduced in newborn animals from diabetic mothers. PMID: 27389246 showed a significant down-regulation in mRNA expression of synaptophysin in the offspring born to diabetic animals PMID: 26794272 Synaptophysin spinal cord levels were higher in balance and coordination trained animals compared with non-trained following sciatic nerve crush. PMID: 26316168 the Nociceptin/orphanin FQ receptor system influences the expression of synaptophysin PMID: 25697061 Results identified interesting differences between thienorphine and morphine in their effects on synaptic structure and synaptophysin expression in the rat NAc. PMID: 24861887 Synaptophysin content was high in all the layers of the cortex, but the most intense reaction was detected in the molecular layer, similarly with the intensity of GFAP reaction PMID: 25282817 data suggest that diabetes increases mRNA translation of synaptophysin in the retina, resulting in an accumulation of mannose rich glycosylated synaptophysin, a transient post-translational state of the protein PMID: 22970294 Phosphorylation and nitration of tyrosine residues affect functional properties of Synaptophysin and Dynamin I. PMID: 23103755 The expression of synaptophysin (SYP) and regenerationassociated protein (GAP43) in the injured brain of neural stem cells-transplanted rats was significantly increased. PMID: 21687946 The developmental changes of GluR2 and SYP expression in the rat inferior colliculus may be involved in the development and plasticity of the auditory center. PMID: 20422983 GAP-43 and P38 may be the pathological basis of insular epilepsy and the key molecular mechanism of synaptic plasticity. PMID: 20646586 Our findings implicate decreases in the number of surviving cells and alterations in the levels of caveolin-1 and synaptophysin in the impairments in neural development induced by developmental iodine deficiency and hypothyroidism. PMID: 20025630 stress during pregnancy reduced the expression of synaptophysin; this decrease provides evidence that synaptic integral membrane proteins are involved in altered synaptic plasticity in the adult CNS following stress exposure PMID: 20035832 The expression level of synaptophysin showed dynamic changes following diffuse brain injury as well as during the repair period. PMID: 17330749 Data suggest that synaptophysin I has multiple roles in neurotransmitter release, regulating VAMP2 availability for the soluble N-ethylmaleimide-sensitive factor attachment protein receptor complex and participating in the late steps of exocytosis PMID: 12181340 Synaptophysin mRNA increased in the barrel cortex contralateral to whisker stimulation, suggesting that synaptophysin is involved in the modulation of synaptic plasticity. PMID: 12363201 We found a kindling-induced increase in synaptophysin in various hippocampal regions and in pyriform cortex, suggesting that activation-induced sprouting extends well beyond the hippocampal mossy fiber system. cortex PMID: 12453493 Synaptophysin and gamma-adaptin occurred in the perinuclear region of hippocampal neurons, suggesting that synaptophysin serves as a docking site for AP-1 during clathrin-dependent vesicle budding and/or kinesin-based transport reactions. PMID: 12498786 synaptophysin targeting to a ubiquitous synaptic vesicle-sized compartment is facilitated by cellugyrin and synaptogyrin PMID: 12928441 Synaptophysin expression was assessed in dentate gyrus prepared from aged (22 months) and young (4 months) rats; marked reduction in synaptophysin expression in synaptosomes of aged compared with young rats was noted PMID: 12965244 Restraint stress decreased SYP in rat hippocampus by 50% and increased microtubule-associated protein 1(MAP1) by 60%. SYP returned to pre-stress levels in three weeks and MAP1 in two weeks. PMID: 15584914 Cognitive impairment and the expression patterns of MAP-2, GAP-43, and synaptophysin were examined in rats with permanent occlusion of bilateral common carotid arteries. PMID: 15964096 The dose-response effects of Aroclor 1254 on the expression of alpha-synuclein, synaptophysin and parkin in rat brains is reported. PMID: 16174552 Following clozapine treatment, synaptophysin expression increases in the very cortical regions in which GLT-1 expression is down-regulated. PMID: 16987241 The mRNA expression level of synaptophysin induced by neuronal activity is related to the regulation of synapse formation or remodeling or both. PMID: 16990974 Synaptophysin expression, which appeared diffusely across the cortex, increased on day 1, 3, and 5 of complex motor skill learning. PMID: 17141532 AMPH administered in the AMPH-paired context increased the density of both Fos and synaptophysin immunoreactivity in the dentate gyrus, cornu ammonis (CA)1, CA3, basolateral amygdala and dorsolateral striatum. PMID: 17970739 reduced synaptophysin protein levels in schizophrenia postmortem brains do not result from perinatal oxygen deprivation PMID: 18626794 Synaptophysin gene is embedded in open chromatin in R28 retinal precursor cells. PMID: 18692536 We found abnormal expression of the synaptic proteins synaptophysin, microtubule-associated protein 2 (MAP2) and cyclin-dependent kinase 5 (CDK5) and of the neurotrophin-3. PMID: 18703118 Results show that nerve growth factor regulates the intracellular distribution of the synaptic vesicle protein synaptophysin in newborn rat trigeminal ganglion neurons in vitro. PMID: 19019428

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Rat Synaptophysin (SYP) Protein (His)

Recombinant Rat Synaptophysin (SYP) Protein (His)

Product Overview

Target Details

FAQs