Recombinant Rat Suppressor Of Cytokine Signaling 3 (SOCS3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10706P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Suppressor Of Cytokine Signaling 3 (SOCS3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10706P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Suppressor Of Cytokine Signaling 3 (SOCS3) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O88583 |
| Target Symbol | SOCS3 |
| Synonyms | Socs3; Cish3Suppressor of cytokine signaling 3; SOCS-3; Cytokine-inducible SH2 protein 3 |
| Species | Rattus norvegicus (Rat) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
| Expression Range | 1-225aa |
| Protein Length | Full Length |
| Mol. Weight | 26.8kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity and regulates IL6 signaling. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. |
| Database References | KEGG: rno:89829 STRING: 10116.ENSRNOP00000003940 UniGene: PMID: 28326931 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
