Recombinant Rat SCF Protein
Beta LifeScience
SKU/CAT #: BLA-1898P
Recombinant Rat SCF Protein
Beta LifeScience
SKU/CAT #: BLA-1898P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P21581 |
Synonym | C kit ligand C-kit ligand Ckit ligand DCUA DFNA69 DKFZp686F2250 familial progressive hyperpigmentation 2 FPH2 FPHH KIT ligand Kitl KITLG KL 1 KL1 Mast cell growth factor MGF MGF stem cell factor SCF SCF_HUMAN SF SHEP7 sKITLG Soluble KIT ligand Steel factor steel, mouse, homolog of Stem cell factor Stem cell factor precursor |
Description | Recombinant rat SCF Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMV THLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVK ESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKD SRVSVTKPFMLPPVA |
Molecular Weight | 19 kDa |
Purity | >95% SDS-PAGE.>95 % by HPLC analysis |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The ED50 as determined by a cell proliferation assay using murine MC/9-2 mast cells is less than 5 ng/mL, corresponding to a specific activity of > 2.0 x105 IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. |