Recombinant Rat Regucalcin (RGN) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09094P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Rat Regucalcin (RGN) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09094P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description Recombinant Rat Regucalcin (RGN) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q03336
Target Symbol RGN
Synonyms Rgn; Smp30; Regucalcin; RC; Gluconolactonase; GNL; EC 3.1.1.17; Senescence marker protein 30; SMP-30
Species Rattus norvegicus (Rat)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG
Expression Range 1-299aa
Protein Length Full Length
Mol. Weight 49.4kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities.
Subcellular Location Cytoplasm.
Protein Families SMP-30/CGR1 family
Database References
Tissue Specificity Detected in liver (at protein level). Hepatocytes and renal proximal tubular epithelium.

Gene Functions References

  1. The renal SMP30 expression levels positively correlated with plasma testosterone levels in the kidney. PMID: 27553527
  2. Melatonin may produce a neuroprotective effect through its antioxidant action and by increasing hippocampal expression of SMP30 and osteopontin. PMID: 29602294
  3. n. These results showed the effect of RGN in inhibiting the glycolytic metabolism in rat prostate, which was underpinned by a reduced cell proliferation index. The present findings also suggest that the loss of RGN may predispose to a hyper glycolytic profile and fostered proliferation of prostate cells PMID: 26553531
  4. results highlighted the importance of RGN as a regulatory protein in Ca2+-dependent signaling pathways and its deregulation of RGN expression by Ca2+o may contribute for onset and progression of PCa. PMID: 26171977
  5. RGN overexpression protects germ cell from apoptosis induced by noxious stimuli, which could be a relevant mechanism for fertility preservation in situations of oncological treatments. PMID: 24519986
  6. A diminished influx of Ca2+ in epididymal tissues of RGN-overexpressing rats resulted in compromised sperm motility. PMID: 23615721
  7. Regucalcin may play a pivotal role in the regulation of Ca(2+) signaling which is stimulated through a neurotransmitter in the brain neurons with aging PMID: 22652898
  8. existence of multiple forms of SMP30 PMID: 21347421
  9. Rgn is a novel androgen-target gene in rat testis and may have a role in male reproductive function, particularly in the control of spermatogenesis. PMID: 21680783
  10. Studies indicate that regucalcin plays an important role as a regulatory protein in cell signaling system, and it is proposed to play a pivotal role in keep of cell homeostasis and function. PMID: 21431902
  11. SMP30 protein levels were not altered in cortex and cerebellum of young (6 months) and old (21 months) rats. PMID: 19437547
  12. effect of regucalcin, a regulatory protein of Ca2+ signaling, on guanosine-5'-triphosphatase (GTPase) activity in isolated rat liver plasma membranes was investigated; GTPase activity was significantly increased by the addition of Ca2+ PMID: 11693188
  13. study demonstrates that endogenous regucalcin has a suppressive effect on DNA synthesis in the nuclei of rat renal cortex PMID: 11936841
  14. endogenous regucalcin plays a suppressive role in the enhancement of nuclear DNA synthesis activity in regenerating liver with cell proliferation after partial hepatectomy in rats. PMID: 11967991
  15. Role of regucalcin as an activator of sarcoplasmic reticulum Ca2+-ATPase activity in rat heart muscle PMID: 12112029
  16. Role of endogenous regucalcin in transgenic rats: suppression of kidney cortex cytosolic protein phosphatase activity and enhancement of heart muscle microsomal Ca2+-ATPase activity PMID: 12210758
  17. endogenous regucalcin has a suppressive effect on the enhancement of RNA synthesis activity in the nucleus of regenerating rat liver with proliferative cells PMID: 12397604
  18. recombinant RGPR-p117 did not bind directly to the TTGGC sequence of the regucalcin gene promoter region in liver PMID: 12647292
  19. has a suppressive effect on nitric oxide synthase activity in the liver cytosol; may play important role as a regulatory protein of NO synthase in liver cells PMID: 12647304
  20. Endogenous regucalcin has an inhibitory effect on NO synthase activity in the brain cytosol of young and aged rats PMID: 12686401
  21. The present study demonstrates that endogenous regucalcin has a suppressive effect on NO synthase activity in the kidney cortex cytosol of rats PMID: 12851718
  22. endogenous regucalcin plays a suppressive role in the regulation of liver nuclear function in rats PMID: 12851719
  23. endogenous regucalcin plays a suppressive role in the regulation of brain function in rats PMID: 12964038
  24. regucalcin is expressed in rat bone marrow cells, and osteoclastic bone resorption is stimulated in regucalcin transgenic rats with increasing age PMID: 14767576
  25. overexpression of regucalcin has a suppressive effect on cell death induced by TNF-alpha or thapsigargin PMID: 15108356
  26. Senescence marker protein-30 is a unique enzyme that hydrolyzes diisopropyl phosphorofluoridate in the liver PMID: 15251439
  27. regucalcin modulates the transcriptional process by binding to protein and DNA in the nucleus PMID: 15254778
  28. Endogenous rgn suppresses protein tyrosine phosphatase activity in rat liver microsomes in transgenic rats. PMID: 15289895
  29. Osteoclastic bone resporption is stimulated in regucalcin transgenic male and female rats with increasing age. PMID: 15289899
  30. The effect of regucalcin in increasing superoxide dismutase (SOD) activity may not involve the sulfhydryl group of SOD. PMID: 15340235
  31. hyperlipidemia is uniquely induced in regucalcin TG rats with increasing age PMID: 15375596
  32. regucalcin increases superoxide dismutase activity in the heart cytosol of rats, and its effect is not related to the sulfhydryl group of enzymes PMID: 15375603
  33. This study demonstrates that regucalcin directly stimulates osteoclast-like cell formation in mouse marrow culture in vitro, and that the protein stimulates bone resorption in rat femoral tissues in vitro PMID: 15578574
  34. Overexpression of regucalcin suppresses sulforaphane-induced apoptotic cell death which is partly mediated through caspase-3. PMID: 15806309
  35. study demonstrates that regucalcin regulates the function of osteoblastic cells, and that the protein suppresses cell differentiation and mineralization PMID: 16052480
  36. Results demonstrate that overexpression of regucalcin has a suppressive effect on cell proliferation, which is mediated through various signaling pathways. PMID: 16142398
  37. This study demonstrates that overexpression of RGPR-p117 enhances the expression of regucalcin mRNA and its protein level in NRK52E cells. RGPR-p117 may play a role as a transcriptional factor. PMID: 16273285
  38. RGPR-p117 can enhance the regucalcin promoter activity which is related to the NF-1 consensus sequences including TTGGC motif, and its enhancing effect is partly mediated through phosphorylation and dephosphorylation PMID: 16676356
  39. the SMP30 transcriptional process is redox-sensitive and its modulation occurs at DNA binding sites 3 and 5 in the promoter region PMID: 16677110
  40. This study demonstrates that overexpression of regucalcin caused a remarkable increase in its nuclear localization, and that it has suppressive effects on the gene expression of L-type Ca(2+) channel or CaR. PMID: 16767692
  41. Results suggest regucalcin has a role in the regulation of heart mitochondrial function. PMID: 16786169
  42. Regucalcin does not have effects as the suppressor for free radical stress and the scavenger for free radical in rats. PMID: 17334641
  43. Leptin mRNA expression in the adipose or liver tissues was significantly decreased in 50-week-old regucalcin transgenic rats. PMID: 17671736
  44. This study demonstrates that overexpression of regucalcin suppresses the enhancing effect of insulin or glucose on the gene expression of insulin signaling-related proteins in the cloned rat hepatoma H4-II-E cells. PMID: 17912465
  45. Data show that regucalcin mRNA and protein are present in rat mammary gland that estradiol down-regulates regucalcin expression. PMID: 18157649
  46. regucalcin has a role in the regulation of Ca(2+)-ATPase activity in the brain mitochondria of rats PMID: 18181158
  47. These studies provide novel insights into the mechanism that regulate SMP30 gene expression. PMID: 18442420

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from High-Quality Recombinant Proteins
Sale
Recombinant Human PARP2 Protein (N-GST & C-6xHis)
  • Molecule: PARP2;
  • Species: Human;
  • Expression system: Baculovirus;
  • Tag: N-terminal GST-tagged and C-terminal 6xHis-tagged;
  • Sequence: Full Length;
CAT#: BLC-11423P

Save $650
Sale
Greater than 85% as determined by SDS-PAGE.
Recombinant Human ACP3 Protein (C-10xHis)
  • Molecule: ACP3;
  • Species: Human;
  • Expression system: Baculovirus;
  • Tag: C-terminal 10xHis-tagged;
  • Sequence: Partial of Isoform 2;
CAT#: BLC-11438P

Save $650
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human MUSK Protein (TBD)
  • Molecule: MUSK;
  • Species: Human;
  • Expression system: in vitro E.coli expression system;
  • Tag: TBD;
  • Sequence: Partial;
CAT#: BLC-11435P

Save $650
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human SLC39A1 Protein (N-GST)
  • Molecule: SLC39A1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-terminal GST-tagged;
  • Sequence: Cytoplasmic Domain;
CAT#: BLC-11425P

Save $650
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human TLR5 Protein (C-6xHis)
  • Molecule: TLR5;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: C-terminal 6xHis-tagged;
  • Sequence: Partial;
CAT#: BLC-11405P

Save $650
Sale
Greater than 85% as determined by SDS-PAGE.
Recombinant Human GPR20 Protein (N-10xHis)
  • Molecule: GPR20;
  • Species: Human;
  • Expression system: in vitro E.coli expression system;
  • Tag: N-terminal 10xHis-tagged;
  • Sequence: Full Length;
CAT#: BLC-11447P

Save $650
Recently viewed