Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10094P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10094P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P25031
Target Symbol REG3B
Synonyms Reg3b; Pap; Pap1; Reg2; Regenerating islet-derived protein 3-beta; REG-3-beta; Pancreatitis-associated protein 1; Peptide 23; REG-2; Regenerating islet-derived protein III-beta; Reg III-beta) [Cleaved into: Regenerating islet-derived protein 3-beta 16.5 kDa form; Regenerating islet-derived protein 3-beta 15 kDa form]
Species Rattus norvegicus (Rat)
Expression System E.coli
Tag N-6His
Target Protein Sequence EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
Expression Range 27-175aa
Protein Length Full Length of Mature Protein
Mol. Weight 20.6kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.
Subcellular Location Secreted. Note=Found in the apical region of pancreatic acinar cells.
Database References

KEGG: rno:24618

STRING: 10116.ENSRNOP00000008212

UniGene: PMID: 29305881

  • Reg3beta-dependent accumulation of macrophages in the ischemic heart has a role in myocardial healing PMID: 25751817
  • Alox15 mRNA levels were 4 times higher in iron-deficient than in iron-adequate pancreas and that Reg1a, Reg3a, and Reg3b mRNA levels were 17-36 times higher in iron-overloaded pancreas. PMID: 24465846
  • Regenerating 1 and 3b gene expression in the pancreas of type 2 diabetic Goto-Kakizaki (GK) rats PMID: 24587207
  • Findings suggest that islet neogenesis-associated protein (INGAP) exerts a positive modulatory effect on beta-cell mass and its secretory function in fetal and neonatal rats, thus becoming a new component in the multifactorial regulation of such processes. PMID: 23303201
  • After duodenal-jejunal bypass, the level of Reg3alpha and -3beta were not changed in bypassed duodenum in morbidly obese Zucker fatty rats. PMID: 23370676
  • In older animals, there is depressed PAP expression related to a blunted inflammatory response in acute pancreatitis which is associated with worsened bacterial infiltration and higher C-reactive protein level PMID: 22807607
  • PAP-I and PAP-III induction in non-gamma- aminobutyric acid (GABA)ergic neurons might protect these neurons against damage following seizure. PMID: 21093549
  • Letter: aggregation status of PAP1 and PAP2 could change their role in regulating the inflammation in acute pancreatitis. PMID: 21926556
  • Pancreatitis-associated protein I could play a role similar to that of IL-10 in epithelial cells. PMID: 16517747
  • Thus, PAP family members may have an anti-inflammatory role, and this may contribute to the protection of injured neurons. PMID: 19351265
  • There is a tight spatial and temporal association between pre-inflammatory changes or inflammation and PAP-expression PMID: 15100001
  • Sepsis resulted in an up-regulation of PAP-1 gene expression and increase in its protein level in pancreas. The functional role of PAP-1 production in sepsis needs further investigation. PMID: 15211109
  • These results suggest that Reg family members would be new mediators among injured neurons and glial cells, and may play pivotal roles during nerve regeneration. PMID: 15896308
  • pancreatitis-associated protein-I is implicated in the abnormal sensation in cystitis. PMID: 18295254
  • The Reg/PAP family, which was found to show dramatically increasing gene expressions by DNA microarray analysis, was suspected to play an important role in myocarditis. PMID: 18774541
  • Results indicated that the mechanism of PAP1 action involves the activation of the mitogen-activated protein kinase superfamily. PMID: 19434369
  • PAP1 mrna expression was higher in vena cava versus thoracic aorta. PMID: 19571575
  • Results indicate that PAP-1 may be a defensive gene for oxidative stress-induced cell death of pancreatic acinar cells. PMID: 19723102
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed