Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10094P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10094P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P25031 |
| Target Symbol | REG3B |
| Synonyms | Reg3b; Pap; Pap1; Reg2; Regenerating islet-derived protein 3-beta; REG-3-beta; Pancreatitis-associated protein 1; Peptide 23; REG-2; Regenerating islet-derived protein III-beta; Reg III-beta) [Cleaved into: Regenerating islet-derived protein 3-beta 16.5 kDa form; Regenerating islet-derived protein 3-beta 15 kDa form] |
| Species | Rattus norvegicus (Rat) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG |
| Expression Range | 27-175aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 20.6kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues. |
| Subcellular Location | Secreted. Note=Found in the apical region of pancreatic acinar cells. |
| Database References | KEGG: rno:24618 STRING: 10116.ENSRNOP00000008212 UniGene: PMID: 29305881 |
