Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His)

Name: Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10094P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Rat Regenerating Islet-Derived Protein 3-Beta (REG3B) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P25031
Target Symbol	REG3B
Synonyms	Reg3b; Pap; Pap1; Reg2; Regenerating islet-derived protein 3-beta; REG-3-beta; Pancreatitis-associated protein 1; Peptide 23; REG-2; Regenerating islet-derived protein III-beta; Reg III-beta) [Cleaved into: Regenerating islet-derived protein 3-beta 16.5 kDa form; Regenerating islet-derived protein 3-beta 15 kDa form]
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
Expression Range	27-175aa
Protein Length	Full Length of Mature Protein
Mol. Weight	20.6kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.
Subcellular Location	Secreted. Note=Found in the apical region of pancreatic acinar cells.
Database References	KEGG: rno:24618 STRING: 10116.ENSRNOP00000008212 UniGene: Rn.9727
Associated Diseases	Overexpressed during the acute phase of pancreatitis.
Tissue Specificity	Constitutively expressed in intestine.

Gene Functions References

These results demonstrate a direct effect of INGAP-PP on the liver acting through P-Akt signaling pathway. INGAP-PP enhances liver glucose metabolism and deposit and reduces its production/output, thereby contributing to maintain normal glucose homeostasis. PMID: 29305881
Reg3beta-dependent accumulation of macrophages in the ischemic heart has a role in myocardial healing PMID: 25751817
Alox15 mRNA levels were 4 times higher in iron-deficient than in iron-adequate pancreas and that Reg1a, Reg3a, and Reg3b mRNA levels were 17-36 times higher in iron-overloaded pancreas. PMID: 24465846
Regenerating 1 and 3b gene expression in the pancreas of type 2 diabetic Goto-Kakizaki (GK) rats PMID: 24587207
Findings suggest that islet neogenesis-associated protein (INGAP) exerts a positive modulatory effect on beta-cell mass and its secretory function in fetal and neonatal rats, thus becoming a new component in the multifactorial regulation of such processes. PMID: 23303201
After duodenal-jejunal bypass, the level of Reg3alpha and -3beta were not changed in bypassed duodenum in morbidly obese Zucker fatty rats. PMID: 23370676
In older animals, there is depressed PAP expression related to a blunted inflammatory response in acute pancreatitis which is associated with worsened bacterial infiltration and higher C-reactive protein level PMID: 22807607
PAP-I and PAP-III induction in non-gamma- aminobutyric acid (GABA)ergic neurons might protect these neurons against damage following seizure. PMID: 21093549
Letter: aggregation status of PAP1 and PAP2 could change their role in regulating the inflammation in acute pancreatitis. PMID: 21926556
Pancreatitis-associated protein I could play a role similar to that of IL-10 in epithelial cells. PMID: 16517747
Thus, PAP family members may have an anti-inflammatory role, and this may contribute to the protection of injured neurons. PMID: 19351265
There is a tight spatial and temporal association between pre-inflammatory changes or inflammation and PAP-expression PMID: 15100001
Sepsis resulted in an up-regulation of PAP-1 gene expression and increase in its protein level in pancreas. The functional role of PAP-1 production in sepsis needs further investigation. PMID: 15211109
These results suggest that Reg family members would be new mediators among injured neurons and glial cells, and may play pivotal roles during nerve regeneration. PMID: 15896308
pancreatitis-associated protein-I is implicated in the abnormal sensation in cystitis. PMID: 18295254
The Reg/PAP family, which was found to show dramatically increasing gene expressions by DNA microarray analysis, was suspected to play an important role in myocarditis. PMID: 18774541
Results indicated that the mechanism of PAP1 action involves the activation of the mitogen-activated protein kinase superfamily. PMID: 19434369
PAP1 mrna expression was higher in vena cava versus thoracic aorta. PMID: 19571575
Results indicate that PAP-1 may be a defensive gene for oxidative stress-induced cell death of pancreatic acinar cells. PMID: 19723102

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.