Recombinant Rat Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (His)

Name: Recombinant Rat Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03147P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Rat Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P35231
Target Symbol	REG3A
Synonyms	Reg3a; Pap2; Reg3; Regenerating islet-derived protein 3-alpha; REG-3-alpha; Islet of Langerhans regenerating protein 3; REG 3; Lithostathine 3; Pancreatitis-associated protein 2; RegIII; Regenerating islet-derived protein III-alpha; Reg III-alpha) [Cleaved into: Regenerating islet-derived protein 3-alpha 16.5 kDa form; Regenerating islet-derived protein 3-alpha 15 kDa form]
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
Expression Range	26-174aa
Protein Length	Full Length of Mature Protein
Mol. Weight	20.5kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Subcellular Location	Secreted.
Database References	KEGG: rno:171162 STRING: 10116.ENSRNOP00000008468 UniGene: Rn.11222
Associated Diseases	Overexpressed during the acute phase of pancreatitis.
Tissue Specificity	Low expression found in healthy pancreas.

Gene Functions References

The pancreas reacts to remote lesions and septic insults in mice and rats with increased PSP synthesis, while PAP is selectively responsive to septic events. Furthermore, our results suggest that serum PSP in septic patients is predominantly derived through an acute phase response of the pancreas. PMID: 28415799
Findings suggest that islet neogenesis-associated protein (INGAP) exerts a positive modulatory effect on beta-cell mass and its secretory function in fetal and neonatal rats, thus becoming a new component in the multifactorial regulation of such processes. PMID: 23303201
After duodenal-jejunal bypass, the level of Reg3alpha and -3beta were not changed in bypassed duodenum in morbidly obese Zucker fatty rats. PMID: 23370676
Letter: aggregation status of PAP1 and PAP2 could change their role in regulating the inflammation in acute pancreatitis. PMID: 21926556
There is a tight spatial and temporal association between pre-inflammatory changes or inflammation and PAP-expression. PMID: 15100001
Small interfering RNA-mediated gene knockdown of PAP worsens pancreatitis. Differences in gene knockdown technology may provide different approaches to study gene function. PMID: 18437087
Pancreatitis-associated protein 2 stimulates macrophage activity and likely modulates the inflammatory environment of pancreatitis PMID: 18641332
preincubation with select rPAP2 mutant proteins affect translocation of this transcription factor into the nucleus PMID: 18641333

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.