Recombinant Rat Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03147P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03147P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Regenerating Islet-Derived Protein 3-Alpha (REG3A) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P35231 |
| Target Symbol | REG3A |
| Synonyms | Reg3a; Pap2; Reg3; Regenerating islet-derived protein 3-alpha; REG-3-alpha; Islet of Langerhans regenerating protein 3; REG 3; Lithostathine 3; Pancreatitis-associated protein 2; RegIII; Regenerating islet-derived protein III-alpha; Reg III-alpha) [Cleaved into: Regenerating islet-derived protein 3-alpha 16.5 kDa form; Regenerating islet-derived protein 3-alpha 15 kDa form] |
| Species | Rattus norvegicus (Rat) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ |
| Expression Range | 26-174aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 20.5kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. |
| Subcellular Location | Secreted. |
| Database References | KEGG: rno:171162 STRING: 10116.ENSRNOP00000008468 UniGene: PMID: 28415799 |
