Recombinant Rat Protein S100-A4 (S100A4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03949P
Greater than 85% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Recombinant Rat Protein S100-A4 (S100A4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03949P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Protein S100-A4 (S100A4) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P05942 |
| Target Symbol | S100A4 |
| Synonyms | S100a4; Protein S100-A4; Metastasin; Nerve growth factor-induced protein 42A; P9K; Placental calcium-binding protein; S100 calcium-binding protein A4 |
| Species | Rattus norvegicus (Rat) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK |
| Expression Range | 2-101aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 18.6 kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9. Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis. Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels. Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes. In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors. |
| Subcellular Location | Secreted. Nucleus. Cytoplasm. |
| Protein Families | S-100 family |
| Database References | KEGG: rno:24615 STRING: 10116.ENSRNOP00000015958 UniGene: PMID: 28235243 |
