Recombinant Rat Pleiotrophin (PTN) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06972P

Greater than 85% as determined by SDS-PAGE.
Recombinant Rat Pleiotrophin (PTN) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06972P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Pleiotrophin (PTN) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P63090 |
Target Symbol | PTN |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
Expression Range | 33-168aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 19.4 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Secreted growth factor that mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors. Binds cell-surface proteoglycan receptor via their chondroitin sulfate (CS) groups. Thereby regulates many processes like cell proliferation, cell survival, cell growth, cell differentiation and cell migration in several tissues namely neuron and bone. Also plays a role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation. Binds PTPRZ1, leading to neutralization of the negative charges of the CS chains of PTPRZ1, inducing PTPRZ1 clustering, thereby causing the dimerization and inactivation of its phosphatase activity leading to increased tyrosine phosphorylation of each of the PTPRZ1 substrates like ALK or AFAP1L2 in order to activate the PI3K-AKT pathway. Through PTPRZ1 binding, regulates endothelial cell migration and controls oligodendrocyte precursor cell differentiation. Forms a complex with PTPRZ1 and integrin alpha-V/beta-3 (ITGAV:ITGB3) that stimulates endothelial cell migration through SRC dephosphorylation and activation that consequently leads to ITGB3 'Tyr-773' phosphorylation. In adult hippocampus promotes dendritic arborization, spine development, and functional integration and connectivity of newborn granule neurons through ALK by activating AKT signaling pathway. Binds GPC2 and chondroitin sulfate proteoglycans (CSPGs) at the neuron surface, leading to abrogation of binding between PTPRS and CSPGs and neurite outgrowth promotion. Binds SDC3 and mediates bone formation by recruiting and attaching osteoblasts/osteoblast precursors to the sites for new bone deposition. Binds ALK and promotes cell survival and cell proliferation through MAPK pathway activation. Inhibits proliferation and enhances differentiation of neural stem cells by inhibiting FGF2-induced fibroblast growth factor receptor signaling pathway. Mediates regulatory mechanisms in normal hemostasis and in hematopoietic regeneration and in maintaining the balance of myeloid and lymphoid regeneration. In addition may play a role in the female reproductive system, auditory response and the progesterone-induced decidualization pathway. |
Subcellular Location | Secreted. |
Protein Families | Pleiotrophin family |
Database References | |
Tissue Specificity | Expressed in brain. Hardly expressed in bone. Abundantly expressed in the growth plate. Intensely expressed in the cartilage matrix that forms the hollow for the secondary ossification center. Is expressed selectively by the osteocytes of the lamellar bon |
Gene Functions References
- PTN and RPTPbeta/zeta are expressed in spinal deformities caused by mechanical loading, and their expression depends on the type and severity of the applied strain. PMID: 26615567
- Pleiotrophin is a novel genetic factor that plays a role in morphine withdrawal syndrome. PMID: 26222257
- We hypothesize a role for these cytokines in mediating, at least in part, acute neuroprotective effects and chronic neurotrophic adaptations that contribute to drug dependence. PMID: 25108770
- These findings provide new insight into the neuroprotective role of PTN PMID: 23000062
- PTN significantly prevented glutamate-induced neurotoxicity of cultured hippocampal neurons. PMID: 21928404
- (HARP)/pleiotrophin, a cytokine known to regulate developmental chondrocyte formation, were enhanced especially at 4 weeks, without up-regulation of HARP/pleiotrophin mRNA in overuse tendon injury. PMID: 21688311
- pleiotrophin expression in rat liver PMID: 11999218
- PTN is secreted from activated adult hepatic stellate cells and embryonic mesenchymal cells as a mitogen of parenchymal cells in adult and embryonic liver, respectively. PMID: 12057922
- that PTN is up-regulated in DA-depleted striatum and exhibits a trophic effect specifically on the survival of cultured dopaminergic neurons. PMID: 12786979
- Using immunohistochemical techniques we could show that PTN is expressed in fracture callus, while this angiogenic peptide was undetectable in normal bone. PMID: 14586627
- PTN signals new blood vessel formation through its ability to stimulate different functions in different cell types not limited to the endothelial cell PMID: 15949466
- thrombospondin type I repeat domains of the heparin-binding growth-associated molecule bind to heparin/heparan sulfate and regulate neurite extension and plasticity in hippocampal neurons PMID: 16155004
- hypoxia and platelet-derived growth factor mediated induction of PTN expression in sinusoidal hepatic stellate cells may provide a strong mitogenic signal for hepatocytes to limit the damage to the parenchymal cells in biliary-type liver fibrogenesis PMID: 16226713
- PTN-immunolabeled neurons contained nitric oxide synthase or somatostatin and expressed the vesicular acetylcholine transporter, supporting that they were GABAergic nitric oxide synthase/somatostatin-containing and cholinergic interneurons PMID: 16325783
- Together, these results demonstrate that influence of CNTF family of cytokines on the differentiation of late retinal progenitor cell population is partially mediated by the release of Ptn. PMID: 16914133
- Pleiotrophin is a neurotrophic factor for spinal motor neurons PMID: 17360581
- PTN was identified as a factor that plays a role in the nigrostriatal system during development and in response to disease, and may therefore be useful for neuroprotection or reconstruction of the dopamine system PMID: 17368428
- HARP negatively affects diverse biological activities in C6 glioma cells, mainly due to binding of HARP to VEGF, which may sequester secreted VEGF from signalling through VEGFR2. PMID: 17881084
- upregulation of PTN, but not MK, could play an important role in the recovery from nerve damage PMID: 18365878
- pleiotrophin (PTN) and syndecan-2 and -3 as direct binding partners of Y-P30. PMID: 18599487
- Pleiotrophin prevents cocaine-induced toxicity in vitro. PMID: 18727926
- PTN inhibits hippocampal LTP in vitro and might play a role in memory processes in vivo. PMID: 19384682