Recombinant Rat Phospholipase A2, Membrane Associated (PLA2G2A) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-10622P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Rat Phospholipase A2, Membrane Associated (PLA2G2A) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-10622P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Rat Phospholipase A2, Membrane Associated (PLA2G2A) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P14423
Target Symbol PLA2G2A
Synonyms Pla2g2a; Phospholipase A2; membrane associated; EC 3.1.1.4; GIIC sPLA2; Group IIA phospholipase A2; Phosphatidylcholine 2-acylhydrolase 2A
Species Rattus norvegicus (Rat)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC
Expression Range 22-146aa
Protein Length Full Length of Mature Protein
Mol. Weight 30.1kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids with implications in host antimicrobial defense, inflammatory response and tissue regeneration. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane. Upon sterile inflammation, targets membrane phospholipids of extracellular mitochondria released from activated platelets, generating free unsaturated fatty acids such as arachidonate that is used by neighboring leukocytes to synthesize inflammatory eicosanoids such as leukotrienes. Simultaneously, by compromising mitochondrial membrane integrity, promotes the release in circulation of potent damage-associated molecular pattern molecules that activate the innate immune response. Plays a stem cell regulator role in the intestinal crypt. Within intracellular compartment mediates Paneth cell differentiation and its stem cell supporting functions by inhibiting Wnt signaling pathway in intestinal stem cell (ICS). Secreted in the intestinal lumen upon inflammation, acts in an autocrine way and promotes prostaglandin E2 synthesis that stimulates Wnt signaling pathway in ICS cells and tissue regeneration. May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism and inflammation. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines. Independent of its catalytic activity, acts as a ligand for integrins. Binds to and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1. Binds to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and induces integrin conformational changes and enhanced ligand binding to site 1. Induces cell proliferation in an integrin-dependent manner.
Subcellular Location Secreted. Cell membrane; Peripheral membrane protein. Mitochondrion outer membrane; Peripheral membrane protein.
Protein Families Phospholipase A2 family
Database References

KEGG: rno:29692

STRING: 10116.ENSRNOP00000022827

UniGene: PMID: 26162096

  • a novel inverse recruitment mechanism in which liganded TRbeta recruits corepressors to inhibit PLA2g2a expression. PMID: 23629656
  • Secreted PLA2-IIA regulates the permeability of microvascular endothelial cells during brain inflammation. PMID: 22788969
  • Data show changes in cell morphology and upregulation of ERK1/2, iNOS and sPLA-IIA expression in astrocytes and microglia on exposure to lipopolysaccharides and cytokines. PMID: 21943492
  • cPLA(2)alpha-mediated induction of PPAR-beta/delta is a novel intracellular signalling pathway in spontaneous and TGF-beta induced activation of hepatic stellate cells. PMID: 22093332
  • The expression of sPLA(2)-IIA in the dorsal horn and spinal trigeminal nucleus is consistent with previous results which showed an important role of CNS sPLA(2) in nociceptive transmission. PMID: 20153419
  • calcium-independent phospholipase A2beta has a role in high glucose-induced activation of RhoA, Rho kinase, and CPI-17 in cultured vascular smooth muscle cells and vascular smooth muscle hypercontractility in diabetic animals PMID: 20086008
  • During atherogenesis, SAA can amplify the involvement of smooth muscle cells in vascular inflammation and that this can lead to deposition of sPLA(2) and subsequent local changes in lipid homeostasis. PMID: 19850938
  • A calcium-independent, type IIA secretory phospholipase A2 newly isolated from liver mitochondria, most apparent in media of high ionic strength, initiates the removal of poorly functioning mitochondria by processes involving autolysis. PMID: 12056909
  • sPLA(2) may modulate neuronal COX-2 expression through mechanisms that differ from those of glutamate-induced COX-2 expression PMID: 12111798
  • analysed the activation of sPLA(2) transcription by cAMP and interleukin-1beta and showed that the 500 bp region upstream of the transcription start site of the sPLA(2) gene is implicated in activation by synergistically acting cAMP and IL-1beta PMID: 12188923
  • tumor necrosis factor alpha-induced secreted phospholipase A2 (sPLA2)-IIA expression is potentiated in mesangial cells by an autocrine loop involving sPLA2 and peroxisome proliferator-activated receptor alpha activation PMID: 12782627
  • Transcriptional activation of the group IIA secretory phospholipase A2 gene in vascular smooth muscle. PMID: 12882648
  • in a neonatal model, the development of an acidic surface pH can be ascribed, in part, to progressive stratum corneum acidification by two endogenous mechanisms, namely, sPLA2 and NHE1 PMID: 15009712
  • We investigated temporal and spatial expression of sPLA2-IIA mRNA and immunoreactivity in transient focal cerebral ischemia, demonstrating an up-regulation of the inflammatory sPLA2-IIA in reactive astrocytes in response to cerebral ischemia-reperfusion. PMID: 15255941
  • new autocrine and paracrine pathways activating sPLA2-IIA gene expression in rat and human vascular smooth muscle cells PMID: 15802623
  • 12/15-LOX-dependent up-regulation of sPLA2-IIA expression may result from the interplay between accelerated MIP-2 signaling, AP-1 activation, and attenuated transforming growth factor-beta and platelet-derived growth factor signaling PMID: 15878884
  • the neuritogenic effect of sPLA2 is mediated by generation of LPC and subsequent activation of G2A PMID: 15927955
  • These results indicate that phospholipase A(2)-IIA is coexpressed with SNAP-25 in mature taste receptor cells that possess exocytotic machinery. PMID: 16385482
  • cytosolic and group IIA secreted phospholipases A(2) work together to liberate arachidonate from phospholipids in response to cytokines PMID: 16603549
  • HMGB1 slightly activated the sPLA2-IIA, COX-2, and mPGES-1 genes but dramatically stimulated these genes in VSMCs that had been incubated with the proinflammatory cytokine IL-1beta PMID: 16807371
  • It was shown that exposure of cultured astrocytes to oxygen glucose deprivation (0.5-24h) causes an increase in cPLA(2) and sPLA(2) expression and activity. PMID: 17462919
  • a novel regulatory role of iPLA(2)gamma in stimulus-coupled sPLA(2)-IIA expression. PMID: 17475622
  • On Chr 5, Pla2g2a is subject to a syntenic control while expression of the Tp53 (Chr 10) and Pmai1/Noxa (Chr 18) genes appears to be controlled by several mammary cancer resistance QTLs. PMID: 19052818
  • Simvastatin may reduce the process of atherosclerosis by decreasing the expression level of sPLA2 IIa in myocardium and aorta. PMID: 19237014
  • sPLA(2)-IIA may be an important mediator of oligodendrocyte death and a novel target for therapeutic intervention following spinal cord injury PMID: 19306380
  • Reactive oxygen species from NADPH oxidase iare involved in cytokine induction of sPLA2-IIA in astrocytes. Botanical antioxidants may be protective agents for inhibition of inflammatory responses in these cells. PMID: 19375465
  • sPLA2-derived oxidative products contribute to significant neurovascular damage, and treatment with sPLA2 inhibitor DEDA ameliorates secondary injury by reducing exacerbations from lipoxidative stress. PMID: 19678934
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed