Recombinant Rat Nadph Oxidase 4 (NOX4) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-08593P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Nadph Oxidase 4 (NOX4) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-08593P
Collections: Fc receptors, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Rat Nadph Oxidase 4 (NOX4) Protein (His-B2M) is produced by our E.coli expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q924V1 |
| Target Symbol | NOX4 |
| Synonyms | Nox4; Kox; NADPH oxidase 4; EC 1.6.3.-; Kidney oxidase-1; KOX-1; Kidney superoxide-producing NADPH oxidase |
| Species | Rattus norvegicus (Rat) |
| Expression System | E.coli |
| Tag | N-6His-B2M |
| Target Protein Sequence | GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE |
| Expression Range | 210-424aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 38.6kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. |
| Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell junction, focal adhesion. Note=May localize to plasma membrane and focal adhesions. |
| Database References | |
| Tissue Specificity | Expressed in vascular smooth muscle. |
Gene Functions References
- chronic intermittent hypoxia-induced elevation of blood pressure is at least partially mediated via the Nox4-induced ROS/RhoA/ROCK pathway PMID: 28078487
- This study, for the first time, demonstrates that Nox4 is an oxygen-sensing enzyme and a main ROS source in NP cells. Nox4-dependent ROS are genotoxic and a potent trigger of NP cell senescence. Nox4 is a potential therapeutic target for disc cell senescence and IDD. PMID: 29147462
- The results demonstrate that the heightened sensitivity of the brain to ischemic damage is due to an organ-specific role of NOX4 in blood-brain barrier endothelial cells and neurons. PMID: 29087944
- Results indicate that intermedin exerts anti-oxidant effects by inhibition of Nox4, and the effect can be mediated by cAMP-PKA pathway in unilateral ureteral obstruction induced renal fibrosis. PMID: 28805491
- CYLD contributes to the transdifferentiation of adventitial fibroblasts via deubiquitinating Nox4 and may play a role in vascular remodeling. PMID: 28751569
- Oxygen-glucose deprivation/reoxygenation increased MEG3 and NOX4 expression in rat brain microvascular endothelial cells. PMID: 28634073
- increased mTAL luminal flow results in increases in intracellular and mitochondrial H2O2, which are dependent on the presence of Nox4, and that p67phox/Nox2 accounts solely for increases in O2 (.-) production PMID: 27279484
- Xbp1s plays an important role in NOX4-triggered cardiomyocyte hypertrophy via activating its downstream effector RIPK1, which may prove significant for the development of future therapeutic strategies. PMID: 27929749
- Nox4 activation in Vacular Smooth Muscle Cells contributes to actin depolymerization after hypoxia, which could be the underlying mechanism for myogenic tone impairment following ischemia/reperfusion. PMID: 27558234
- Upregulation of Nox4 is an important mechanism of cellular and mitochondrial oxidative stress leading to apoptotic cell death in cardiac myocytes following chronic beta- agonist stimulation. PMID: 26631573
- Luminal flow in thick ascending limbs leads to Nox4 recruitment to the nuclear region of thick ascending limb cells and an increase in O2 production. PMID: 27033446
- Acute restraint stress exacerbates the contractile hyper-reactivity in diabetic carotid arteries by enhancing Nox4 functionality. PMID: 26387612
- Hsp70 and CHIP mediates the ubiquitination and proteasomal degradation of Nox4 as part of the antioxidative effect of Losartan in spontaneous hypertensive rats. PMID: 26279425
- the reduced renal injury and attenuated blood pressure response to high salt in the SS(Nox4-/-) rat could be the result of multiple pathways by the knock out of Nox4. PMID: 26644237
- Glycated albumin increases the permissiveness of proximal tubular cells to fibrosis and apoptosis in vitro by triggering a pathway that involves Nox4. PMID: 25681565
- Results suggest that Nox4-mediated reactive oxygen species generation likely plays important role in fate determination and differentiation of neural crest stem cells. PMID: 25410908
- siNOX4 transfection markedly reduced rhBMP4-induced elevation of TRPC1 and 6 proteins. PMID: 25203114
- this study demonstrated a previously unrecognized protective role of Nox4, a ROS-generating enzyme and the major Nox isoform in CMECs, against H/R injury by inhibiting apoptosis and promoting migration and angiogenesis PMID: 24480752
- RhoA/ROCK is upstream of Poldip2-dependent Nox4 regulation and ROS production and induces redox signaling of kidney myofibroblast activation and may have broader implications in the pathophysiology of renal fibrosis. PMID: 24872317
- Nox4 is prominently expressed in the adventitia and contributes to altered fibroblast behavior, hypertensive vascular remodeling, and development of pulmonary hypertension. PMID: 24947524
- NOX4 activation is a decisive component in hepatic ischemia-reperfusion induced microcirculatory dysfunction. PMID: 24636100
- hyperglycemia could increase albumin permeability across the podocyte filtration barrier via Nox4-dependent PKGIalpha dimerization PMID: 24041960
- Data show that hypercholesterolemia affects myocardial microRNA expression, and by down-regulating microRNA-25 increases NOX4 expression and consequently oxidative/nitrative stress in the heart. PMID: 23722270
- Atrial fibroblasts show greater fibrotic and oxidative responses to TGF-beta1 than ventricular fibroblasts and suggest role for Nox4. PMID: 23884197
- Increased 8-OHdG concentration in the culture medium and higher expression of Nox-1, Nox-4, and p22(phox) mRNAs (3-6-fold) were observed in cells treated with AGE3. PMID: 23225244
- these results indicate that IL-1beta-dependent activation of PKCdelta is modulated by NOX4-derived ROS. PMID: 23022406
- the thyroid gland of females is exposed to higher oxidative stress levels due both to increased reactive oxygen species (ROS) production through NOX4, and decreased ROS degradation PMID: 23033809
- Nox4D is a nuclear-localized and functionally active splice variant of Nox4 that may have important pathophysiologic effects through modulation of nuclear signaling and DNA damage in vascular cells. PMID: 23393389
- Phenylephrine increased Nox4 protein expression and cardiomyocyte hypertrophy in a dose-dependent manner in cultured neonatal rat heart cells. PMID: 23271793
- Telmisartan downregulates myocardial expression of Nox4 in type 2 diabetic rats. PMID: 22873349
- NOX4 is the main catalytic isoform of NADPH oxidase that contributes to oxygen production in the thick ascending limb of kidney. PMID: 22875785
- Study shows that testosterone induces vascular smooth muscle cells (VSMCs) migration via NADPH oxidase (Nox1 and Nox4 mRNA levels and p47phox)-derived reactive oxygen species (ROS) and c-Src-dependent pathways. PMID: 22566500
- Abnormal expression of NADPH oxidase plays an important role in progression of hypertensive renal damage in spontaneously hypertensive rats. PMID: 21646815
- In the aorta, Nox4 expression was increased by three-fold in obese rats. PMID: 22195989
- This study provides strong evidence that Nox4 is an important source of reactive oxygen species (ROS) in the left ventricle and that Nox4-derived ROS contribute to cardiomyopathy at early stages of type 1 diabetes PMID: 22031600
- Intracellular reactive oxygen species formation partly through an increasing NOX4 activity in response to high pacing frequency is associated with an increased atrial natriuretic peptide secretion. PMID: 22063193
- IGF-I induces an increase in expression of Nox4 in cultured renal proximal tubular epithelial cells. PMID: 21940672
- Expression of Nox4 was increased in vascular smooth muscle cells from SHR. Nox4,alone or in association,may be involved in NAD(P)H oxidase-mediated ROS production. PMID: 21419746
- High NOX4 expression is associated with colon cancers. PMID: 20715105
- Our results indicate that miR-25 as an endogenous gene silencing factor importantly contributes to the regulation of NOX4 gene expression in diabetic nephropathy. PMID: 21071935
- Bilirubin and biliverdin protect rodents against diabetic nephropathy by downregulating NAD(P)H oxidase. PMID: 20686447
- Upregulation of Nox4 by hypertrophic stimuli and aging induces oxidative stress, apoptosis and left ventricular dysfunction, via mitochondrial insufficiency caused by increased O(2)(-) production and cysteine oxidation in mitochondrial proteins. PMID: 20185797
- Translocation of Hsp70 to proximal tubule membranes in SHRLos might exert a cytoprotective effect by down-regulation of NADPH subunits Nox4. PMID: 20016382
- NADPH oxidase-derived reactive oxygen species is one of critical components of a signal transduction pathway that links puromycin aminonucleoside nephrosis to TRPC6-mediated Ca(2+) signaling. PMID: 19910702
- Nox4-based NAD(P)H oxidase and generation of reactive oxygen species mediate the effect of ANG II on Akt/PKB activation and protein synthesis in glomerular mesangial cells PMID: 12842860
- Nox4 co-localizes with vinculin in focal adhesions in vascular smooth muscle cells. Its role may be correlated with its compartmentalization in focal adhesions. PMID: 14670934
- cardiac fibroblasts express Nox4/p22 phox-containing oxidant generating complex activated by H(2)O(2) PMID: 15848200
- role for Nox4 as the major source of ROS in the kidneys during early stages of diabetes PMID: 16135519
- Nox4-derived reactive oxygen species are critical to the maintenance of the differentiated phenotype of vascular smooth muscle cells. PMID: 17082491
- blood pressure and angiotensin II type 1 receptor activation are involved in the up-regulation of Nox1 and Nox4 expression, which could contribute to vascular injury during chronic hypertension PMID: 17283869
